Property Summary

NCBI Gene PubMed Count 24
PubMed Score 9.67
PubTator Score 8.44

Knowledge Summary


No data available


  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
Kidney cancer 2548 0.0 0.5


Gene RIF (5)

AA Sequence

PSVLSGPMQAALQAAAHASVDIKNVLDFYKQWKEIG                                      981 - 1016

Text Mined References (27)

PMID Year Title