Property Summary

NCBI Gene PubMed Count 48
PubMed Score 56.78
PubTator Score 1002.66

Knowledge Summary

Patent (29,795)

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.800 7.4e-03
oligodendroglioma 1.100 1.2e-02
psoriasis -2.400 1.6e-03
osteosarcoma 1.605 6.9e-05
juvenile dermatomyositis 1.212 3.3e-10
Amyotrophic Lateral Sclerosis 1.037 7.5e-05
acute quadriplegic myopathy 1.886 1.1e-05
intraductal papillary-mucinous neoplasm ... 1.600 1.6e-02
Breast cancer 2.800 2.6e-02
Pick disease -2.700 7.6e-07
progressive supranuclear palsy -2.100 5.6e-03
ovarian cancer 1.400 9.7e-03

Gene RIF (28)

PMID Text
25760059 Knock down of the expression of SMG-1 inhibited tumor cell proliferation and induced the chemosensitivity of pancreatic cancer cells in vitro.
25257528 SMG1 was hypermethylated in 66% of AML samples compared with none in controls. mTOR expression level was negatively correlated to SMG1 expression in AML patients which indicated that SMG1 and mTOR maybe act antagonistically to regulate AML cell growth.
25017961 A genome-wide RNA interference screen Hepatocellular carcinoma cell lines revealed the role of suppressor of SMG-1 as determinant of sorafenib resistance.
25002321 SMG1 regulates NMD by recruiting UPF1 and UPF2 to distinct nearby positions, and can form a complex with UPF2 in vivo in an UPF1-independent manner.
24700316 We conclude that SMG-1 is downregulated in HCC and may represent a promising biomarker for predicting the prognosis of HCC, including the prognosis of early-stage patients.
24204929 SMG1 protein levels were significantly reduced in brain.
24185201 Downregulation of SMG1 causes the reduction in the level of Upf1 phosphorylation and delays adipogenesis, suggesting the functional involvement of SMG1 in adipogenesis via SMD.
24173962 This study demonstrated the quantitative regulation of Upf1 and Upf2 proteins by ubiquitin-proteasome system and SMG1.
24107632 Novel role for SMG-1 is identified in regulating Cdc25A and suppressing oncogenic CDK2 driven proliferation, confirming SMG-1 as a tumor suppressor.
23583196 Data indicate that down-regulation of SMG1 expression is mediated by miRNA-125 binding to a microRNA response element in the 3' untranslated region of SMG1 mRNA, which leads to degradation of the SMG1 mRNA.
23277562 the inflammation observed in Smg1 haploinsufficiency contributes to susceptibility to cancer, and Smg1-deficient animals represent a model of inflammation-enhanced cancer development
22247495 Levels of SMG-1 expression negatively correlated with HPV status in cancer cell lines and tumors.
21911475 stress granule formation appears more complex than originally envisaged and hSMG-1 plays a central role in this process.
21701263 SMG1 plays independent roles in responding to DNA, RNA damage and a broader role in protection against cellular stress tna other member of the PIKK family.
21418860 The inhibition of hSMG-1 significantly enhances the sensitivity of human lung cancer H1299 cells to gemcitabine and cisplatin.
21307779 Hyperglycemia (both 10 and 20 mM)-treated monocyte showed up-regulated phosphorylation of p101 and p110gamma subunits of PI-3 kinase in comparison to 5 mM glucose.
21245168 large-scale conformational changes induced by SMG-8 after SMG-9-mediated recruitment tune SMG-1 kinase activity to modulate nonsense-mediated mRNA decay
20864032 The CK2 phospho-dependent interaction between TEL2 and the R2TP complex affects phosphatidylinositol 3-kinase-related kinase functions and is essential for mTOR and SMG1 stability in vivo.
20723581 The results of this study indicated a significant impact of brief naturalistic stressors on AS-mediated regulation of gene expression in peripheral leukocytes, and suggest the SMG-1 splice variant as a potential biomarker for acute psychological stress
19765550 The phosphatidylinositol 3-kinase pathway plays a critical role in the transfer of signal from morphine stimuli to mu opioid receptor gene transcription.
19417104 SMG-8 and SMG-9 suppress SMG-1 kinase activity in the isolated SMG-1 complex and are involved in Nonsense-mediated mRNA decay in both mammals and nematodes
19406746 SMG-1 negatively regulated HIF-1alpha activity in hypoxia, in part through blocking MAPK activation.
18332866 hSMG-1 and ATM sequentially and independently regulate the G1 checkpoint during oxidative stress
18326048 hSMG-1 plays an important role in cell survival during TNFalpha-induced stress
17229728 distantly located N- and C-terminal sequences are essential for the intrinsic kinase activity of SMG-1
16452507 Thus, the SMG-1-mediated phosphorylation of Upf1 occurs on the association of SURF with EJC, which provides the link between the EJC and recognition of PTCs and triggers NMD
15279777 hSMG-1 teams with ATM and ATR to insure the overall quality of the transcriptome in human cells [review]
15175154 Expression of hSMG-1 is required for optimal p53 activation after cellular exposure to genotoxic stress, and depletion of hSMG-1 leads to spontaneous DNA damage and increased sensitivity to ionizing radiation.

AA Sequence

MSRRAPGSRLSSGGGGGGTKYPRSWNDWQPRTDSASADPDNLKYSSSRDRGGSSSYGLQPSNSAVVSRQR      1 - 70
HDDTRVHADIQNDEKGGYSVNGGSGENTYGRKSLGQELRVNNVTSPEFTSVQHGSRALATKDMRKSQERS     71 - 140
MSYSDESRLSNLLRRITREDDRDRRLATVKQLKEFIQQPENKLVLVKQLDNILAAVHDVLNESSKLLQEL    141 - 210
RQEGACCLGLLCASLSYEAEKIFKWIFSKFSSSAKDEVKLLYLCATYKALETVGEKKAFSSVMQLVMTSL    211 - 280
QSILENVDTPELLCKCVKCILLVARCYPHIFSTNFRDTVDILVGWHIDHTQKPSLTQQVSGWLQSLEPFW    281 - 350
VADLAFSTTLLGQFLEDMEAYAEDLSHVASGESVDEDVPPPSVSLPKLAALLRVFSTVVRSIGERFSPIR    351 - 420
GPPITEAYVTDVLYRVMRCVTAANQVFFSEAVLTAANECVGVLLGSLDPSMTIHCDMVITYGLDQLENCQ    421 - 490
TCGTDYIISVLNLLTLIVEQINTKLPSSFVEKLFIPSSKLLFLRYHKEKEVVAVAHAVYQAVLSLKNIPV    491 - 560
LETAYKLILGEMTCALNNLLHSLQLPEACSEIKHEAFKNHVFNVDNAKFVVIFDLSALTTIGNAKNSLIG    561 - 630
MWALSPTVFALLSKNLMIVHSDLAVHFPAIQYAVLYTLYSHCTRHDHFISSSLSSSSPSLFDGAVISTVT    631 - 700
TATKKHFSIILNLLGILLKKDNLNQDTRKLLMTWALEAAVLMKKSETYAPLFSLPSFHKFCKGLLANTLV    701 - 770
EDVNICLQACSSLHALSSSLPDDLLQRCVDVCRVQLVHSGTRIRQAFGKLLKSIPLDVVLSNNNHTEIQE    771 - 840
ISLALRSHMSKAPSNTFHPQDFSDVISFILYGNSHRTGKDNWLERLFYSCQRLDKRDQSTIPRNLLKTDA    841 - 910
VLWQWAIWEAAQFTVLSKLRTPLGRAQDTFQTIEGIIRSLAAHTLNPDQDVSQWTTADNDEGHGNNQLRL    911 - 980
VLLLQYLENLEKLMYNAYEGCANALTSPPKVIRTFFYTNRQTCQDWLTRIRLSIMRVGLLAGQPAVTVRH    981 - 1050
GFDLLTEMKTTSLSQGNELEVTIMMVVEALCELHCPEAIQGIAVWSSSIVGKNLLWINSVAQQAEGRFEK   1051 - 1120
ASVEYQEHLCAMTGVDCCISSFDKSVLTLANAGRNSASPKHSLNGESRKTVLSKPTDSSPEVINYLGNKA   1121 - 1190
CECYISIADWAAVQEWQNAIHDLKKSTSSTSLNLKADFNYIKSLSSFESGKFVECTEQLELLPGENINLL   1191 - 1260
AGGSKEKIDMKKLLPNMLSPDPRELQKSIEVQLLRSSVCLATALNPIEQDQKWQSITENVVKYLKQTSRI   1261 - 1330
AIGPLRLSTLTVSQSLPVLSTLQLYCSSALENTVSNRLSTEDCLIPLFSEALRSCKQHDVRPWMQALRYT   1331 - 1400
MYQNQLLEKIKEQTVPIRSHLMELGLTAAKFARKRGNVSLATRLLAQCSEVQLGKTTTAQDLVQHFKKLS   1401 - 1470
TQGQVDEKWGPELDIEKTKLLYTAGQSTHAMEMLSSCAISFCKSVKAEYAVAKSILTLAKWIQAEWKEIS   1471 - 1540
GQLKQVYRAQHQQNFTGLSTLSKNILTLIELPSVNTMEEEYPRIESESTVHIGVGEPDFILGQLYHLSSV   1541 - 1610
QAPEVAKSWAALASWAYRWGRKVVDNASQGEGVRLLPREKSEVQNLLPDTITEEEKERIYGILGQAVCRP   1611 - 1680
AGIQDEDITLQITESEDNEEDDMVDVIWRQLISSCPWLSELDESATEGVIKVWRKVVDRIFSLYKLSCSA   1681 - 1750
YFTFLKLNAGQIPLDEDDPRLHLSHRVEQSTDDMIVMATLRLLRLLVKHAGELRQYLEHGLETTPTAPWR   1751 - 1820
GIIPQLFSRLNHPEVYVRQSICNLLCRVAQDSPHLILYPAIVGTISLSSESQASGNKFSTAIPTLLGNIQ   1821 - 1890
GEELLVSECEGGSPPASQDSNKDEPKSGLNEDQAMMQDCYSKIVDKLSSANPTMVLQVQMLVAELRRVTV   1891 - 1960
LWDELWLGVLLQQHMYVLRRIQQLEDEVKRVQNNNTLRKEEKIAIMREKHTALMKPIVFALEHVRSITAA   1961 - 2030
PAETPHEKWFQDNYGDAIENALEKLKTPLNPAKPGSSWIPFKEIMLSLQQRAQKRASYILRLEEISPWLA   2031 - 2100
AMTNTEIALPGEVSARDTVTIHSVGGTITILPTKTKPKKLLFLGSDGKSYPYLFKGLEDLHLDERIMQFL   2101 - 2170
SIVNTMFATINRQETPRFHARHYSVTPLGTRSGLIQWVDGATPLFGLYKRWQQREAALQAQKAQDSYQTP   2171 - 2240
QNPGIVPRPSELYYSKIGPALKTVGLSLDVSRRDWPLHVMKAVLEELMEATPPNLLAKELWSSCTTPDEW   2241 - 2310
WRVTQSYARSTAVMSMVGYIIGLGDRHLDNVLIDMTTGEVVHIDYNVCFEKGKSLRVPEKVPFRMTQNIE   2311 - 2380
TALGVTGVEGVFRLSCEQVLHIMRRGRETLLTLLEAFVYDPLVDWTAGGEAGFAGAVYGGGGQQAESKQS   2381 - 2450
KREMEREITRSLFSSRVAEIKVNWFKNRDEMLVVLPKLDGSLDEYLSLQEQLTDVEKLQGKLLEEIEFLE   2451 - 2520
GAEGVDHPSHTLQHRYSEHTQLQTQQRAVQEAIQVKLNEFEQWITHYQAAFNNLEATQLASLLQEISTQM   2521 - 2590
DLGPPSYVPATAFLQNAGQAHLISQCEQLEGEVGALLQQRRSVLRGCLEQLHHYATVALQYPKAIFQKHR   2591 - 2660
IEQWKTWMEELICNTTVERCQELYRKYEMQYAPQPPPTVCQFITATEMTLQRYAADINSRLIRQVERLKQ   2661 - 2730
EAVTVPVCEDQLKEIERCIKVFLHENGEEGSLSLASVIISALCTLTRRNLMMEGAASSAGEQLVDLTSRD   2731 - 2800
GAWFLEELCSMSGNVTCLVQLLKQCHLVPQDLDIPNPMEASETVHLANGVYTSLQELNSNFRQIIFPEAL   2801 - 2870
RCLMKGEYTLESMLHELDGLIEQTTDGVPLQTLVESLQAYLRNAAMGLEEETHAHYIDVARLLHAQYGEL   2871 - 2940
IQPRNGSVDETPKMSAGQMLLVAFDGMFAQVETAFSLLVEKLNKMEIPIAWRKIDIIREARSTQVNFFDD   2941 - 3010
DNHRQVLEEIFFLKRLQTIKEFFRLCGTFSKTLSGSSSLEDQNTVNGPVQIVNVKTLFRNSCFSEDQMAK   3011 - 3080
PIKAFTADFVRQLLIGLPNQALGLTLCSFISALGVDIIAQVEAKDFGAESKVSVDDLCKKAVEHNIQIGK   3081 - 3150
FSQLVMNRATVLASSYDTAWKKHDLVRRLETSISSCKTSLQRVQLHIAMFQWQHEDLLINRPQAMSVTPP   3151 - 3220
PRSAILTSMKKKLHTLSQIETSIATVQEKLAALESSIEQRLKWAGGANPALAPVLQDFEATIAERRNLVL   3221 - 3290
KESQRASQVTFLCSNIIHFESLRTRTAEALNLDAALFELIKRCQQMCSFASQFNSSVSELELRLLQRVDT   3291 - 3360
GLEHPIGSSEWLLSAHKQLTQDMSTQRAIQTEKEQQIETVCETIQNLVDNIKTVLTGHNRQLGDVKHLLK   3361 - 3430
AMAKDEEAALADGEDVPYENSVRQFLGEYKSWQDNIQTVLFTLVQAMGQVRSQEHVEMLQEITPTLKELK   3431 - 3500
TQSQSIYNNLVSFASPLVTDATNECSSPTSSATYQPSFAAAVRSNTGQKTQPDVMSQNARKLIQKNLATS   3501 - 3570
ADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYV   3571 - 3640
IKEATNLDNLAQLYEGWTAWV                                                    3641 - 3661
//

Text Mined References (63)

PMID Year Title
25760059 2015 Overexpression of serine/threonine-protein kinase-1 in pancreatic cancer tissue: Serine/threonine-protein kinase-1 knockdown increases the chemosensitivity of pancreatic cancer cells.
25257528 2014 SMG1 acts as a novel potential tumor suppressor with epigenetic inactivation in acute myeloid leukemia.
25017961 2014 Genetic screen identifies suppressor of morphogenesis in genitalia-1 (SMG-1) as a modulator of sorafenib resistance in hepatocellular carcinoma cell lines.
25002321 2014 Structures of SMG1-UPFs complexes: SMG1 contributes to regulate UPF2-dependent activation of UPF1 in NMD.
24700316 2014 Expression and significance of the novel tumor-suppressor gene SMG-1 in hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24204929 2013 SMG1 identified as a regulator of Parkinson's disease-associated alpha-synuclein through siRNA screening.
24185201 2013 SMG1 regulates adipogenesis via targeting of staufen1-mediated mRNA decay.
24173962 2014 Proteasome inhibitors and knockdown of SMG1 cause accumulation of Upf1 and Upf2 in human cells.
24107632 2013 SMG-1 suppresses CDK2 and tumor growth by regulating both the p53 and Cdc25A signaling pathways.
23583196 2013 MicroRNA 125 represses nonsense-mediated mRNA decay by regulating SMG1 expression.
23277562 2013 Smg1 haploinsufficiency predisposes to tumor formation and inflammation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22247495 2012 Downregulation of SMG-1 in HPV-positive head and neck squamous cell carcinoma due to promoter hypermethylation correlates with improved survival.
21911475 2011 A novel role for hSMG-1 in stress granule formation.
21701263 2011 The RNA surveillance protein SMG1 activates p53 in response to DNA double-strand breaks but not exogenously oxidized mRNA.
21418860 2011 [Effect of inhibiting the expression of hSMG-1 on chemosensitivity of human non-small cell lung cancer H1299 cells].
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21307779 2011 Effect of hyperglycemia on human monocyte activation.
21269460 2011 Initial characterization of the human central proteome.
21245168 2011 The nonsense-mediated mRNA decay SMG-1 kinase is regulated by large-scale conformational changes controlled by SMG-8.
20864032 2010 CK2 phospho-dependent binding of R2TP complex to TEL2 is essential for mTOR and SMG1 stability.
20810650 2010 A genetic screen identifies the Triple T complex required for DNA damage signaling and ATM and ATR stability.
20723581 2010 Brief naturalistic stress induces an alternative splice variant of SMG-1 lacking exon 63 in peripheral leukocytes.
20427287 2010 Tti1 and Tel2 are critical factors in mammalian target of rapamycin complex assembly.
20371770 2010 AAA+ proteins RUVBL1 and RUVBL2 coordinate PIKK activity and function in nonsense-mediated mRNA decay.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19765550 2010 Mechanisms involved in phosphatidylinositol 3-kinase pathway mediated up-regulation of the mu opioid receptor in lymphocytes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19417104 2009 SMG-8 and SMG-9, two novel subunits of the SMG-1 complex, regulate remodeling of the mRNA surveillance complex during nonsense-mediated mRNA decay.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19406746 2009 Kinome siRNA screen identifies SMG-1 as a negative regulator of hypoxia-inducible factor-1alpha in hypoxia.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18332866 2008 hSMG-1 and ATM sequentially and independently regulate the G1 checkpoint during oxidative stress.
18326048 2008 A protective role for the human SMG-1 kinase against tumor necrosis factor-alpha-induced apoptosis.
18256688 2008 Interactions between UPF1, eRFs, PABP and the exon junction complex suggest an integrated model for mammalian NMD pathways.
17916692 2007 Telomeric repeat containing RNA and RNA surveillance factors at mammalian chromosome ends.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17229728 2007 Distant N- and C-terminal domains are required for intrinsic kinase activity of SMG-1, a critical component of nonsense-mediated mRNA decay.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16488880 2006 The human RNA surveillance factor UPF1 is required for S phase progression and genome stability.
16452507 2006 Binding of a novel SMG-1-Upf1-eRF1-eRF3 complex (SURF) to the exon junction complex triggers Upf1 phosphorylation and nonsense-mediated mRNA decay.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15279777 The ATM-related kinase, hSMG-1, bridges genome and RNA surveillance pathways.
15175154 2004 The mRNA surveillance protein hSMG-1 functions in genotoxic stress response pathways in mammalian cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14636577 2003 Phosphorylation of hUPF1 induces formation of mRNA surveillance complexes containing hSMG-5 and hSMG-7.
12554878 2003 Characterization of human Smg5/7a: a protein with similarities to Caenorhabditis elegans SMG5 and SMG7 that functions in the dephosphorylation of Upf1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11948212 Divergent origins and concerted expansion of two segmental duplications on chromosome 16.
11544179 2001 Human SMG-1, a novel phosphatidylinositol 3-kinase-related protein kinase, associates with components of the mRNA surveillance complex and is involved in the regulation of nonsense-mediated mRNA decay.
11331269 2001 Cloning of a novel phosphatidylinositol kinase-related kinase: characterization of the human SMG-1 RNA surveillance protein.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
10428027 1999 Targeted deficiency or cytosolic truncation of the VE-cadherin gene in mice impairs VEGF-mediated endothelial survival and angiogenesis.
9566925 1998 Localization of atypical protein kinase C isoforms into lysosome-targeted endosomes through interaction with p62.
9455477 1997 Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro.
8524286 1996 Lambda-interacting protein, a novel protein that specifically interacts with the zinc finger domain of the atypical protein kinase C isotype lambda/iota and stimulates its kinase activity in vitro and in vivo.