Property Summary

NCBI Gene PubMed Count 28
PubMed Score 20.03
PubTator Score 13.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.300 3.3e-03
atypical teratoid / rhabdoid tumor 1.100 1.7e-03
Breast cancer 2.300 4.6e-02
diabetes mellitus -1.100 1.4e-03
intraductal papillary-mucinous neoplasm ... 1.100 4.3e-02
lung cancer 1.300 9.1e-04
medulloblastoma 1.100 2.2e-03
medulloblastoma, large-cell 1.100 3.6e-04
non-small cell lung cancer 1.387 5.4e-19
osteosarcoma -2.168 3.7e-07
ovarian cancer 1.300 3.2e-04
Pick disease -1.200 8.3e-05
primary Sjogren syndrome 1.100 4.2e-03
primitive neuroectodermal tumor 1.200 9.8e-04
progressive supranuclear palsy -1.400 5.2e-03

Gene RIF (14)

AA Sequence

MAKRKEENFSSPKNAKRPRQEELEDFDKDGDEDECKGTTLTAAEVGIIESIHLKNFMCHSMLGPFKFGSN      1 - 70
VNFVVGNNGSGKSAVLTALIVGLGGRAVATNRGSSLKGFVKDGQNSADISITLRNRGDDAFKASVYGNSI     71 - 140
LIQQHISIDGSRSYKLKSATGSVVSTRKEELIAILDHFNIQVDNPVSVLTQEMSKQFLQSKNEGDKYKFF    141 - 210
MKATQLEQMKEDYSYIMETKERTKEQIHQGEERLTELKRQCVEKEERFQSIAGLSTMKTNLESLKHEMAW    211 - 280
AVVNEIEKQLNAIRDNIKIGEDRAARLDRKMEEQQVRLNEAEQKYKDIQDKLEKISEETNARAPECMALK    281 - 350
ADVVAKKRAYNEAEVLYNRSLNEYKALKKDDEQLCKRIEELKKSTDQSLEPERLERQKKISWLKERVKAF    351 - 420
QNQENSVNQEIEQFQQAIEKDKEEHGKIKREELDVKHALSYNQRQLKELKDSKTDRLKRFGPNVPALLEA    421 - 490
IDDAYRQGHFTYKPVGPLGACIHLRDPELALAIESCLKGLLQAYCCHNHADERVLQALMKRFYLPGTSRP    491 - 560
PIIVSEFRNEIYDVRHRAAYHPDFPTVLTALEIDNAVVANSLIDMRGIETVLLIKNNSVARAVMQSQKPP    561 - 630
KNCREAFTADGDQVFAGRYYSSENTRPKFLSRDVDSEISDLENEVENKTAQILNLQQHLSALEKDIKHNE    631 - 700
ELLKRCQLHYKELKMKIRKNISEIRELENIEEHQSVDIATLEDEAQENKSKMKMVEEHMEQQKENMEHLK    701 - 770
SLKIEAENKYDAIKFKINQLSELADPLKDELNLADSEVDNQKRGKRHYEEKQKEHLDTLNKKKRELDMKE    771 - 840
KELEEKMSQARQICPERIEVEKSASILDKEINRLRQKIQAEHASHGDREEIMRQYQEARETYLDLDSKVR    841 - 910
TLKKFIKLLGEIMEHRFKTYQQFRRCLTLRCKLYFDNLLSQRAYCGKMNFDHKNETLSISVQPGEGNKAA    911 - 980
FNDMRALSGGERSFSTVCFILSLWSIAESPFRCLDEFDVYMDMVNRRIAMDLILKMADSQRFRQFILLTP    981 - 1050
QSMSSLPSSKLIRILRMSDPERGQTTLPFRPVTQEEDDDQR                                1051 - 1091
//

Text Mined References (34)

PMID Year Title