Property Summary

NCBI Gene PubMed Count 24
PubMed Score 19.95
PubTator Score 13.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma -2.168 3.7e-07
sonic hedgehog group medulloblastoma 1.200 5.0e-03
atypical teratoid / rhabdoid tumor 1.100 1.7e-03
medulloblastoma, large-cell 1.100 3.6e-04
primitive neuroectodermal tumor 1.200 9.8e-04
non-small cell lung cancer 1.387 5.4e-19
intraductal papillary-mucinous neoplasm ... 1.100 4.3e-02
lung cancer 1.300 9.1e-04
diabetes mellitus -1.100 1.4e-03
Breast cancer 2.300 4.6e-02
adult high grade glioma 1.300 3.3e-03
primary Sjogren syndrome 1.100 4.2e-03
Pick disease -1.200 8.3e-05
progressive supranuclear palsy -1.400 5.2e-03
ovarian cancer 1.300 3.2e-04

Gene RIF (10)

PMID Text
26983541 results uncover a novel role for the Smc5/6 complex as a restriction factor selectively blocking extrachromosomal DNA transcription; by destroying this complex, HBx relieves the inhibition to allow productive hepatitis B virus gene expression
25145851 Structural maintenance of chromosomes (SMC) complexes, which in eukaryotic cells include cohesin, condensin and the Smc5/6 complex, are central regulators of chromosome dynamics
24258023 Depletion of Smc5 and Smc6 resulted in aberrant mitotic chromosome phenotypes that were accompanied by the abnormal distribution of topoisomerase IIalpha (topo IIalpha) and condensins and by chromosome segregation errors
21550342 Studies indicate that Nse1 may function as a ubiquitin ligase, and is targeted to chromatin through its interaction with the Smc5/6 complex.
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18667531 Nse1 RING-like motif is a protein-protein interaction domain required for Smc5-Smc6 holocomplex integrity and recruitment to, or retention at, DNA lesions
18086888 The four non-SMC components of the human complex were identified and characterized and it was demonstrated that the MAGEG1 protein is part of this complex.
17589526 SMC5/6 complex facilitates telomere homologous recombination and elongation in alternative lengthening of telomeres cells through SUMOylation of telomere-binding proteins.
16810316 SMC5/6 complex is recruited to nuclease-induced double-strand breaks (DSBs) and is required for the recruitment of cohesin to DSBs.
16055714 the human SMC5/6 complex and the SUMO ligase activity of hMMS21 are required for the prevention of DNA damage-induced apoptosis by facilitating DNA repair in human cells

AA Sequence

MAKRKEENFSSPKNAKRPRQEELEDFDKDGDEDECKGTTLTAAEVGIIESIHLKNFMCHSMLGPFKFGSN      1 - 70
VNFVVGNNGSGKSAVLTALIVGLGGRAVATNRGSSLKGFVKDGQNSADISITLRNRGDDAFKASVYGNSI     71 - 140
LIQQHISIDGSRSYKLKSATGSVVSTRKEELIAILDHFNIQVDNPVSVLTQEMSKQFLQSKNEGDKYKFF    141 - 210
MKATQLEQMKEDYSYIMETKERTKEQIHQGEERLTELKRQCVEKEERFQSIAGLSTMKTNLESLKHEMAW    211 - 280
AVVNEIEKQLNAIRDNIKIGEDRAARLDRKMEEQQVRLNEAEQKYKDIQDKLEKISEETNARAPECMALK    281 - 350
ADVVAKKRAYNEAEVLYNRSLNEYKALKKDDEQLCKRIEELKKSTDQSLEPERLERQKKISWLKERVKAF    351 - 420
QNQENSVNQEIEQFQQAIEKDKEEHGKIKREELDVKHALSYNQRQLKELKDSKTDRLKRFGPNVPALLEA    421 - 490
IDDAYRQGHFTYKPVGPLGACIHLRDPELALAIESCLKGLLQAYCCHNHADERVLQALMKRFYLPGTSRP    491 - 560
PIIVSEFRNEIYDVRHRAAYHPDFPTVLTALEIDNAVVANSLIDMRGIETVLLIKNNSVARAVMQSQKPP    561 - 630
KNCREAFTADGDQVFAGRYYSSENTRPKFLSRDVDSEISDLENEVENKTAQILNLQQHLSALEKDIKHNE    631 - 700
ELLKRCQLHYKELKMKIRKNISEIRELENIEEHQSVDIATLEDEAQENKSKMKMVEEHMEQQKENMEHLK    701 - 770
SLKIEAENKYDAIKFKINQLSELADPLKDELNLADSEVDNQKRGKRHYEEKQKEHLDTLNKKKRELDMKE    771 - 840
KELEEKMSQARQICPERIEVEKSASILDKEINRLRQKIQAEHASHGDREEIMRQYQEARETYLDLDSKVR    841 - 910
TLKKFIKLLGEIMEHRFKTYQQFRRCLTLRCKLYFDNLLSQRAYCGKMNFDHKNETLSISVQPGEGNKAA    911 - 980
FNDMRALSGGERSFSTVCFILSLWSIAESPFRCLDEFDVYMDMVNRRIAMDLILKMADSQRFRQFILLTP    981 - 1050
QSMSSLPSSKLIRILRMSDPERGQTTLPFRPVTQEEDDDQR                                1051 - 1091
//

Text Mined References (29)

PMID Year Title
26983541 2016 Hepatitis B virus X protein identifies the Smc5/6 complex as a host restriction factor.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25931565 2015 DNA repair. Proteomics reveals dynamic assembly of repair complexes during bypass of DNA cross-links.
25145851 2014 The maintenance of chromosome structure: positioning and functioning of SMC complexes.
24258023 2014 Smc5/6-mediated regulation of replication progression contributes to chromosome assembly during mitosis in human cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21550342 2011 The Nse2/Mms21 SUMO ligase of the Smc5/6 complex in the maintenance of genome stability.
21269460 2011 Initial characterization of the human central proteome.
20056645 2010 Association of mitotic regulation pathway polymorphisms with pancreatic cancer risk and outcome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18667531 2008 Nse1 RING-like domain supports functions of the Smc5-Smc6 holocomplex in genome stability.
18086888 2008 Identification of the proteins, including MAGEG1, that make up the human SMC5-6 protein complex.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17589526 2007 The SMC5/6 complex maintains telomere length in ALT cancer cells through SUMOylation of telomere-binding proteins.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16810316 2006 Human SMC5/6 complex promotes sister chromatid homologous recombination by recruiting the SMC1/3 cohesin complex to double-strand breaks.
16381901 2006 The LIFEdb database in 2006.
16055714 2005 Human MMS21/NSE2 is a SUMO ligase required for DNA repair.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15601840 2005 Composition and architecture of the Schizosaccharomyces pombe Rad18 (Smc5-6) complex.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701739 2004 Coordination of DNA damage responses via the Smc5/Smc6 complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11408570 2001 Characterization of a novel human SMC heterodimer homologous to the Schizosaccharomyces pombe Rad18/Spr18 complex.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.