Property Summary

NCBI Gene PubMed Count 25
PubMed Score 5.13
PubTator Score 162.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
psoriasis 1.800 1.8e-03
osteosarcoma -1.335 3.9e-02
glioblastoma 1.800 7.4e-04
medulloblastoma 1.600 3.3e-07
atypical teratoid / rhabdoid tumor 1.600 1.5e-05
medulloblastoma, large-cell 2.200 7.5e-06
primitive neuroectodermal tumor 1.700 5.7e-05
adrenocortical carcinoma 1.595 1.0e-03
non-small cell lung cancer 1.721 5.0e-17
intraductal papillary-mucinous carcinoma... 2.000 5.4e-03
intraductal papillary-mucinous neoplasm ... 2.500 3.9e-03
lung cancer 1.600 1.1e-04
Breast cancer 2.400 2.7e-02
pediatric high grade glioma 1.500 9.1e-05
posterior fossa group A ependymoma 1.400 1.5e-06
nasopharyngeal carcinoma 1.200 1.2e-03
Pick disease -1.100 3.4e-04
progressive supranuclear palsy -1.300 3.0e-03
invasive ductal carcinoma 1.500 1.6e-03
ovarian cancer 1.100 1.3e-02
head and neck cancer -1.300 4.9e-03

Protein-protein Interaction (7)

Gene RIF (8)

PMID Text
26491021 analysis of functional differences of SMC2 and SMC4 hinge domain between condensins and cohesin in DNA recognition
24553121 SMC2 (or the condensin complex) is a novel molecular target for the treatment of MYCN-amplified neuroblastoma.
24483990 SMC2 gene is altered by both frameshift mutation and loss of expression in gastric and colorectal cancers, suggesting that SMC2 gene alterations might be involved in pathogenesis of these cancers
23095742 WNT signaling can directly activate SMC2 transcription as a key player in the mitotic cell division machinery.
21194474 Studies indicate that tagged SMC2 subunit of the condensin complex with the streptavidin-Binding Peptide optimising efficacious use of this tag for protein analysis.
20823528 human SMC2 hinge domain with short coiled coils was cloned, expressed, purified and crystallized in the orthorhombic space group C222 in native and SeMet-derivatized forms
19454010 Interaction of HIV-1 Tat with SMC2 in T-cells is identified by a proteomic strategy based on affinity chromatography coupled with mass spectrometry
17488335 mutation analysis of hCAP-C & hCAP-E in leukemia-lymphoma cell lines including 8 pyothorax-associated lymphoma (PAL); 3 of 8 PAL cell lines have hCAP-C or hCAP-E heterozygous mutations, indicating condensin mutations are relatively frequent in PAL

AA Sequence

MHIKSIILEGFKSYAQRTEVNGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRASNLQDLVYKNG      1 - 70
QAGITKASVSITFDNSDKKQSPLGFEVHDEITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNN     71 - 140
PHFLIMQGRITKVLNMKPPEILSMIEEAAGTRMYEYKKIAAQKTIEKKEAKLKEIKTILEEEITPTIQKL    141 - 210
KEERSSYLEYQKVMREIEHLSRLYIAYQFLLAEDTKVRSAEELKEMQDKVIKLQEELSENDKKIKALNHE    211 - 280
IEELEKRKDKETGGILRSLEDALAEAQRVNTKSQSAFDLKKKNLACEESKRKELEKNMVEDSKTLAAKEK    281 - 350
EVKKITDGLHALQEASNKDAEALAAAQQHFNAVSAGLSSNEDGAEATLAGQMMACKNDISKAQTEAKQAQ    351 - 420
MKLKHAQQELKNKQAEVKKMDSGYRKDQEALEAVKRLKEKLEAEMKKLNYEENKEESLLEKRRQLSRDIG    421 - 490
RLKETYEALLARFPNLRFAYKDPEKNWNRNCVKGLVASLISVKDTSATTALELVAGERLYNVVVDTEVTG    491 - 560
KKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPDNVHVALSLVEYKPELQKAMEFVFGTTFVC    561 - 630
DNMDNAKKVAFDKRIMTRTVTLGGDVFDPHGTLSGGARSQAASILTKFQELKDVQDELRIKENELRALEE    631 - 700
ELAGLKNTAEKYRQLKQQWEMKTEEADLLQTKLQQSSYHKQQEELDALKKTIEESEETLKNTKEIQRKAE    701 - 770
EKYEVLENKMKNAEAERERELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEELKREHTSYKQQL    771 - 840
EAVNEAIKSYESQIEVMAAEVAKNKESVNKAQEEVTKQKEVITAQDTVIKAKYAEVAKHKEQNNDSQLKI    841 - 910
KELDHNISKHKREAEDGAAKVSKMLKDYDWINAERHLFGQPNSAYDFKTNNPKEAGQRLQKLQEMKEKLG    911 - 980
RNVNMRAMNVLTEAEERYNDLMKKKRIVENDKSKILTTIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLP    981 - 1050
GANAMLAPPEGQTVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALD   1051 - 1120
LSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTVARFTQCQNGKISKEAKSKAKPP   1121 - 1190
KGAHVEV                                                                  1191 - 1197
//

Text Mined References (31)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26491021 2015 Structural Basis for Dimer Formation of Human Condensin Structural Maintenance of Chromosome Proteins and Its Implications for Single-stranded DNA Recognition.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24553121 2014 Inactivation of SMC2 shows a synergistic lethal response in MYCN-amplified neuroblastoma cells.
24483990 2014 Mutational and expressional analysis of SMC2 gene in gastric and colorectal cancers with microsatellite instability.
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
23728299 2013 The bromodomain protein Brd4 insulates chromatin from DNA damage signalling.
23095742 2012 Human SMC2 protein, a core subunit of human condensin complex, is a novel transcriptional target of the WNT signaling pathway and a new therapeutic target.
21618603 2011 Evidence for gene-environment interaction in a genome wide study of nonsyndromic cleft palate.
21269460 2011 Initial characterization of the human central proteome.
21194474 2010 Streptavidin-Binding Peptide (SBP)-tagged SMC2 allows single-step affinity fluorescence, blotting or purification of the condensin complex.
20823528 2010 Cloning, expression, crystallization and preliminary X-ray crystallographic analysis of a human condensin SMC2 hinge domain with short coiled coils.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17653272 2007 Rapid identification of malaria vaccine candidates based on alpha-helical coiled coil protein motif.
17488335 2007 Condensin mutations and abnormal chromosomal structures in pyothorax-associated lymphoma.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17314511 2007 Large-scale identification of c-MYC-associated proteins using a combined TAP/MudPIT approach.
17268547 2007 Reconstitution and subunit geometry of human condensin complexes.
17113138 2006 Wapl controls the dynamic association of cohesin with chromatin.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660695 2004 The evolution of SMC proteins: phylogenetic analysis and structural implications.
12589063 2003 In vitro and in vivo interactions of DNA ligase IV with a subunit of the condensin complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11136719 2001 Chromosome condensation by a human condensin complex in Xenopus egg extracts.
10958694 2000 A human condensin complex containing hCAP-C-hCAP-E and CNAP1, a homolog of Xenopus XCAP-D2, colocalizes with phosphorylated histone H3 during the early stage of mitotic chromosome condensation.
9789013 1998 Identification of two distinct human SMC protein complexes involved in mitotic chromosome dynamics.