Property Summary

NCBI Gene PubMed Count 31
PubMed Score 13.26
PubTator Score 11.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.500 1.7e-07
psoriasis -1.500 1.9e-04
osteosarcoma -1.081 2.8e-03
atypical teratoid / rhabdoid tumor 1.900 1.1e-07
glioblastoma 1.900 8.8e-07
medulloblastoma 1.600 3.0e-03
medulloblastoma, large-cell 2.600 4.6e-07
primitive neuroectodermal tumor 1.200 4.7e-03
lung cancer 1.600 2.8e-04
pediatric high grade glioma 1.200 2.4e-04

Gene RIF (5)

PMID Text
26542803 miR-7 expression reduced SMARCD1 protein expression in lung cancer cell lines.
25396734 the association of EGFR, CALM3 and SMARCD1 gene polymorphisms with bone mineral density in white women, as conducted.
19762545 SMARCD1/BAF60a is an androgen receptor cofactor that modulates TMPRSS2 expression
19454010 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
12917342 In addition to previously identified BAF250, BAF60a may provide another critical and direct link between nuclear receptors and the BRG1 complex that is required for promoter recruitment and subsequent chromatin remodeling

AA Sequence

MAARAGFQSVAPSGGAGASGGAGAAAALGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPRPGMLPGSRMT      1 - 70
PQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKKKKMADKILPQRIREL     71 - 140
VPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVASWELR    141 - 210
VEGRLLEDSALSKYDATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNV    211 - 280
RCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVICDKYLQQIFESQ    281 - 350
RMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIATL    351 - 420
DNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVVGNPEEERRAEFYFQPWAQEA    421 - 490
VCRYFYSKVQQRRQELEQALGIRNT                                                 491 - 515
//

Text Mined References (34)

PMID Year Title
26542803 2016 MicroRNA-7 Compromises p53 Protein-dependent Apoptosis by Controlling the Expression of the Chromatin Remodeling Factor SMARCD1.
25416956 2014 A proteome-scale map of the human interactome network.
25396734 2014 Comprehensive analysis of the association of EGFR, CALM3 and SMARCD1 gene polymorphisms with BMD in Caucasian women.
24434208 2014 CARM1 methylates chromatin remodeling factor BAF155 to enhance tumor progression and metastasis.
24421395 2014 Residual complexes containing SMARCA2 (BRM) underlie the oncogenic drive of SMARCA4 (BRG1) mutation.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19762545 2009 Functional screening of FxxLF-like peptide motifs identifies SMARCD1/BAF60a as an androgen receptor cofactor that modulates TMPRSS2 expression.
18765789 2008 Regulation of muscle development by DPF3, a novel histone acetylation and methylation reader of the BAF chromatin remodeling complex.
18303029 2008 BAF60a interacts with p53 to recruit the SWI/SNF complex.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16541075 2006 The finished DNA sequence of human chromosome 12.
16484223 2006 FEZ1 dimerization and interaction with transcription regulatory proteins involves its coiled-coil region.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15985610 2005 PBAF chromatin-remodeling complex requires a novel specificity subunit, BAF200, to regulate expression of selective interferon-responsive genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14698202 2003 Use of a modified yeast one-hybrid screen to identify BAF60a interactions with the Vitamin D receptor heterodimer.
12917342 2003 BAF60a mediates critical interactions between nuclear receptors and the BRG1 chromatin-remodeling complex for transactivation.
12753905 2003 The A20-binding protein ABIN-2 exerts unexpected function in mediating transcriptional coactivation.
12665591 2003 Novel SWI/SNF chromatin-remodeling complexes contain a mixed-lineage leukemia chromosomal translocation partner.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11734557 2002 SYT associates with human SNF/SWI complexes and the C-terminal region of its fusion partner SSX1 targets histones.
11726552 2001 Fanconi anemia protein, FANCA, associates with BRG1, a component of the human SWI/SNF complex.
11078522 2000 The human SWI/SNF-B chromatin-remodeling complex is related to yeast rsc and localizes at kinetochores of mitotic chromosomes.
11053448 2001 Identification of SWI.SNF complex subunit BAF60a as a determinant of the transactivation potential of Fos/Jun dimers.
10078207 1999 Reconstitution of a core chromatin remodeling complex from SWI/SNF subunits.
9892636 1999 Tissue-specific and developmental stage-specific DNA binding by a mammalian SWI/SNF complex associated with human fetal-to-adult globin gene switching.
9710619 1998 A human RNA polymerase II complex containing factors that modify chromatin structure.
9693044 1998 Five SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin (SMARC) genes are dispersed in the human genome.
8895581 1996 Purification and biochemical heterogeneity of the mammalian SWI-SNF complex.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8804307 1996 Diversity and specialization of mammalian SWI/SNF complexes.