Property Summary

NCBI Gene PubMed Count 23
PubMed Score 16.42
PubTator Score 32.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia -1.500 4.7e-02
group 3 medulloblastoma 1.500 7.0e-05
medulloblastoma, large-cell 1.200 1.7e-05
Pick disease -1.100 6.0e-05
primary pancreatic ductal adenocarcinoma 1.112 2.6e-03
primitive neuroectodermal tumor 1.300 7.8e-06

Synonym

Accession Q9H4L7 B7Z799 Q05D56 Q96SX1 Q9H017 Q9H860 Q9NPU9 Q9ULU7
Symbols ETL1
HEL1
ADERM
BASNS

Gene

Gene RIF (8)

AA Sequence

MNLFNLDRFRFEKRNKIEEAPEATPQPSQPGPSSPISLSAEEENAEGEVSRANTPDSDITEKTEDSSVPE      1 - 70
TPDNERKASISYFKNQRGIQYIDLSSDSEDVVSPNCSNTVQEKTFNKDTVIIVSEPSEDEESQGLPTMAR     71 - 140
RNDDISELEDLSELEDLKDAKLQTLKELFPQRSDNDLLKLIESTSTMDGAIAAALLMFGDAGGGPRKRKL    141 - 210
SSSSEPYEEDEFNDDQSIKKTRLDHGEESNESAESSSNWEKQESIVLKLQKEFPNFDKQELREVLKEHEW    211 - 280
MYTEALESLKVFAEDQDMQYVSQSEVPNGKEVSSRSQNYPKNATKTKLKQKFSMKAQNGFNKKRKKNVFN    281 - 350
PKRVVEDSEYDSGSDVGSSLDEDYSSGEEVMEDGYKGKILHFLQDASIGELTLIPQCSQKKAQKITELRP    351 - 420
FNSWEALFTKMSKTNGLSEDLIWHCKTLIQERDVVIRLMNKCEDISNKLTKQVTMLTGNGGGWNIEQPSI    421 - 490
LNQSLSLKPYQKVGLNWLALVHKHGLNGILADEMGLGKTIQAIAFLAYLYQEGNNGPHLIVVPASTIDNW    491 - 560
LREVNLWCPTLKVLCYYGSQEERKQIRFNIHSRYEDYNVIVTTYNCAISSSDDRSLFRRLKLNYAIFDEG    561 - 630
HMLKNMGSIRYQHLMTINANNRLLLTGTPVQNNLLELMSLLNFVMPHMFSSSTSEIRRMFSSKTKSADEQ    631 - 700
SIYEKERIAHAKQIIKPFILRRVKEEVLKQLPPKKDRIELCAMSEKQEQLYLGLFNRLKKSINNLEKNTE    701 - 770
MCNVMMQLRKMANHPLLHRQYYTAEKLKEMSQLMLKEPTHCEANPDLIFEDMEVMTDFELHVLCKQYRHI    771 - 840
NNFQLDMDLILDSGKFRVLGCILSELKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYLRLDGKTQISERI    841 - 910
HLIDEFNTDMDIFVFLLSTKAGGLGINLTSANVVILHDIDCNPYNDKQAEDRCHRVGQTKEVLVIKLISQ    911 - 980
GTIEESMLKINQQKLKLEQDMTTVDEGDEGSMPADIATLLKTSMGL                            981 - 1026
//

Text Mined References (39)

PMID Year Title