Property Summary

NCBI Gene PubMed Count 88
PubMed Score 104.44
PubTator Score 59.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma 1.500 3.9e-02
ependymoma 1.900 2.4e-02
oligodendroglioma 1.600 2.4e-02
psoriasis -2.300 7.8e-04
glioblastoma 1.900 6.6e-06
osteosarcoma 3.605 2.2e-08
group 4 medulloblastoma 1.700 1.2e-04
atypical teratoid / rhabdoid tumor 1.900 2.3e-04
medulloblastoma, large-cell 2.100 4.7e-05
primitive neuroectodermal tumor 1.800 3.8e-04
juvenile dermatomyositis 1.058 1.3e-09
active Crohn's disease 1.061 2.9e-02
pediatric high grade glioma 1.600 7.5e-06
pilocytic astrocytoma 1.400 4.1e-06
Pick disease 1.500 1.4e-06
ovarian cancer -2.300 2.5e-10

Protein-protein Interaction (4)

Gene RIF (47)

PMID Text
26809090 Our findings suggest that suppression of miR-222-3p activity promoted osteogenic differentiation hBMSCs through regulating Smad5-RUNX2 signaling axis.
26400397 miR-23a and miR-27a target SMAD5 and regulate apoptosis in human granulosa cells via the FasL-Fas pathway
26339396 Overexpression of the BMP4/SMAD4/SMAD5 signaling pathway could predict poor clinical outcome in skull base chordomas, suggesting activation of this pathway is involved in chordoma pathogenesis.
25880873 adult human Sertoli cells assumed similar morphological features, stable global gene expression profiles and numerous proteins, and activation of AKT and SMAD1/5 during long-period culture.
25754204 The polycomb group protein L3MBTL1 represses a SMAD5-mediated hematopoietic transcriptional program in human pluripotent stem cells.
25505291 balance between Smad1/5- and Smad2/3-dependent signaling defines the outcome of the effect of TGF-beta on atherosclerosis where Smad1/5 is responsible for proatherogenic effects
24928394 Our results indicated that KGN promoted the type-I collagen synthesis of dermal fibroblasts in vitro and in the dermis of mice through activation of the smad4/smad5 pathway.
24828823 Inhibiting Smurf1 mediated ubiquitination of Smad1/5.
24339730 Specific gene siRNAs knock-down further confirmed the osteogenic effects of Genistein on BMP2, SMAD5 and RUNX2 protein expression
24163009 among the 15 SNPs, rs3206634 was significantly associated with KD in a recessive model (odds ratio = 2.31, p = 0.019), whereas there was no association between any of the 15 SNPs and CALs.
24021264 the shear-induced apoptosis and autophagy are mediated by bone morphogenetic protein receptor type (BMPR)-IB, BMPR-specific Smad1 and Smad5, and p38 mitogen-activated protein kinase.
24008158 HIV-1 Tat-treated pulmonary arterial smooth muscle cells modulate levels of phosphorylated SMAD1/5/8 proteins and SMAD1/5/8-SMAD4 protein complex, which are repressed by cocaine exposure
23918166 Results indicate that BMP/Smad signaling pathway was altered during the period of osteogenesis, and that the activities of p-Smad1/5 were required for Saos-2 cells viability and differentiation induced by fluoride.
23804438 a detailed computational model for TGF-beta signalling that incorporates elements of previous models together with crosstalking between Smad1/5/8 and Smad2/3 channels through a negative feedback loop dependent on Smad7.
23387849 Oscillatory shear stress induces synergistic interactions between specific BMPRs and integrin to activate Smad1/5 through the Shc/FAK/ERK pathway
23384547 ATP production by NaF promotes hypertrophy-like changes via activation of phospho-Smad5
22966907 CD44 signaling regulates phosphorylation of RUNX2. Localization of RUNX2 in the nucleus requires phosphorylation of Smad-5 by integrin alphavbeta3 signaling.
22964636 our studies establish that loss of SMAD1/5 leads to upregulation of PDGFA in ovarian granulosa cells
22897816 TNF activated NF-kappaB pathway and inhibited the phosphorylation of Smad 1/5/8 and BMP-2-induced osteoblastic differentiation in BMMSCs
22452883 Data suggest that Smads 1, 5 and 8 as potential prognostic markers and therapeutic targets for mTOR inhibition therapy of prostate cancer.
22013049 found that restoration of SMAD5, in addition to the TGF-beta type II receptor, which was epigenetically silenced by the latent viral protein latency-associated nuclear antigen, sensitized BC3 cells to the cytostatic effect of TGF-beta signaling
21945631 Results show that BMP4-induced changes in OvCa cell morphology and motility are Smad-dependent with shRNA targeting Smads 1, 4, and 5.
21454478 CHIP inhibits the signaling activities of Smad1/5 by recruiting Smad1/5 from the functional R-/Co-Smad complex and further promoting the ubiquitination/degradation of Smad1/5 in a chaperone-independent manner.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20522807 Prostacyclin analogues inhibited smooth muscle cell proliferation and prevented progression of pulmonary hypertension while enhancing Smad1/5 phosphorylation and Id1 gene expression.
20148926 Studies indicate SMAD5beta isoform plays role in hematopoietic stem cell homeostasis.
19819941 Data suggest that the SMAD family, possibly through disruption of SMAD1/5 or activation of SMAD2/3 may contribute to the pathogenesis of JGCT in humans.
19269967 increases of p16(INK4a) and p21(WAF1/cip1) expression in response to BMP4 were mediated by the Smad1/5/8 signaling pathway.
19247629 Observational study of gene-disease association. (HuGE Navigator)
19244313 5-HT transactivates the serine kinase receptor, BMPR 1A, to activate Smads 1/5/8 via Rho and Rho kinase in in bovine and human pulmonary artery smooth muscle cells
19211612 Observational study of gene-disease association. (HuGE Navigator)
18775991 Endoglin promotes transforming growth factor beta-mediated Smad 1/5/8 signaling and inhibits endothelial cell migration through its association with GIPC
18684712 ALK2(R206H) with Smad1 or Smad5 induced osteoblastic differentiation that could be inhibited by Smad7 or dorsomorphin.
18393632 SMAD 2/3 signaling directly supports NANOG expression, while SMAD 1/5/8 activation moderately represses SOX2.
18310319 The shear-induced G(2)/M arrest and corresponding changes in G(2)/M regulatory protein expression and activity were mediated by alpha(v)beta(3) and beta(1) integrins through bone morphogenetic protein receptor type IA-specific Smad1 and Smad5.
18298822 SMAD5 gene was found to be associated with schizophrenia.
17847004 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17359969 These data suggest autocrine TGF-beta1 antagonizes BMP signaling through modulation of inducible Smad6 and the activity of BMP specific Smad1/5.
16436528 Human granulosa-like tumor cell line KGN expressed BMP type I (BMPR1A and BMPR1B) and type II receptors (BMPR2) and the BMP signaling molecules SMADs (SMAD1 and SMAD5).
16247476 activation by BMP-2 in lung cancer cells
16243555 We used homology-modeling techniques to generate a reliable molecular model of the Smad5 MH1 domain based on the crystal structure of Smad3 MH1 domain
15877825 In mature human B cells, BMP-6 inhibited cell growth, and rapidly induced phosphorylation of Smad5.
14670176 SMAD5 undergoes copy number gain and increased expression, rather than loss of expression, and therefore does not act as a tumor-suppressor gene in hepatocellular carcinoma
12849988 Results demonstrate a mitochondrial distribution of Smad5 in non-stimulated chondroprogenitor cells.
12473652 up-regulated Smad5 mediates apoptosis of gastric epithelial cells induced by Helicobacter pylori infection
12064918 Smad5 activation by BMP4 in human hematopoietic cells results in significantly increased proliferation of erythroid progenitors and formation of glycophorin-A+ cells.
12060751 regulatory signals are active at transcriptionally subnuclear sites

AA Sequence

MTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPGQPSKCVTIPR      1 - 70
SLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVL     71 - 140
VPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSG    141 - 210
PGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELN    211 - 280
NRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSD    281 - 350
SSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGW    351 - 420
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS                             421 - 465
//

Text Mined References (94)

PMID Year Title
26809090 2016 Inhibition of miR-222-3p activity promoted osteogenic differentiation of hBMSCs by regulating Smad5-RUNX2 signal axis.
26400397 2015 miR-23a and miR-27a promote human granulosa cell apoptosis by targeting SMAD5.
26339396 2015 Overexpression of the BMP4/SMAD signaling pathway in skull base chordomas is associated with poor prognosis.
25880873 2015 Long-term culture and significant expansion of human Sertoli cells whilst maintaining stable global phenotype and AKT and SMAD1/5 activation.
25754204 2015 The polycomb group protein L3MBTL1 represses a SMAD5-mediated hematopoietic transcriptional program in human pluripotent stem cells.
25505291 2015 TGF-?1, but not bone morphogenetic proteins, activates Smad1/5 pathway in primary human macrophages and induces expression of proatherogenic genes.
24928394 2014 A heterocyclic molecule kartogenin induces collagen synthesis of human dermal fibroblasts by activating the smad4/smad5 pathway.
24828823 2014 Selective small molecule compounds increase BMP-2 responsiveness by inhibiting Smurf1-mediated Smad1/5 degradation.
24518599 2014 Prostate cancer bone metastases acquire resistance to androgen deprivation via WNT5A-mediated BMP-6 induction.
24449884 2014 Different modes of endothelial-smooth muscle cell interaction elicit differential ?-catenin phosphorylations and endothelial functions.
24339730 2013 Genistein promotion of osteogenic differentiation through BMP2/SMAD5/RUNX2 signaling.
24223191 2013 Upregulation of miR-135b is involved in the impaired osteogenic differentiation of mesenchymal stem cells derived from multiple myeloma patients.
24163009 2014 Genetic polymorphism of SMAD5 is associated with Kawasaki disease.
24021264 2013 Mechanical regulation of cancer cell apoptosis and autophagy: roles of bone morphogenetic protein receptor, Smad1/5, and p38 MAPK.
23918166 2013 Fluoride promotes viability and differentiation of osteoblast-like Saos-2 cells via BMP/Smads signaling pathway.
23891815 2013 BMP-Smad 1/5/8 signalling in the development of the nervous system.
23804438 2013 Computational modelling of Smad-mediated negative feedback and crosstalk in the TGF-? superfamily network.
23610558 2013 Rnf165/Ark2C enhances BMP-Smad signaling to mediate motor axon extension.
23387849 2013 BMP receptor-integrin interaction mediates responses of vascular endothelial Smad1/5 and proliferation to disturbed flow.
23384547 2013 Impaired glycolytic metabolism causes chondrocyte hypertrophy-like changes via promotion of phospho-Smad1/5/8 translocation into nucleus.
22966907 2012 Integrin ?v?3 and CD44 pathways in metastatic prostate cancer cells support osteoclastogenesis via a Runx2/Smad 5/receptor activator of NF-?B ligand signaling axis.
22964636 2013 BMP-specific SMADs function as novel repressors of PDGFA and modulate its expression in ovarian granulosa cells and tumors.
22897816 2013 Activated NF-?B in bone marrow mesenchymal stem cells from systemic lupus erythematosus patients inhibits osteogenic differentiation through downregulating Smad signaling.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22452883 2012 Inhibition of mTORC1 kinase activates Smads 1 and 5 but not Smad8 in human prostate cancer cells, mediating cytostatic response to rapamycin.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22013049 2012 Kaposi's sarcoma-associated herpesvirus-encoded microRNA miR-K12-11 attenuates transforming growth factor beta signaling through suppression of SMAD5.
21945631 2011 Human ovarian cancer cell morphology, motility, and proliferation are differentially influenced by autocrine TGF? superfamily signalling.
21454478 2011 Molecular mechanism of the negative regulation of Smad1/5 protein by carboxyl terminus of Hsc70-interacting protein (CHIP).
21269460 2011 Initial characterization of the human central proteome.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20522807 2010 Smad-dependent and smad-independent induction of id1 by prostacyclin analogues inhibits proliferation of pulmonary artery smooth muscle cells in vitro and in vivo.
20148926 2010 Alternative splicing of SMADs in differentiation and tissue homeostasis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19819941 2009 Smad1-Smad5 ovarian conditional knockout mice develop a disease profile similar to the juvenile form of human granulosa cell tumors.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19269967 2009 BMP4-Smad signaling pathway mediates adriamycin-induced premature senescence in lung cancer cells.
19247629 2009 Investigation of DNA polymorphisms in SMAD genes for genetic predisposition to diabetic nephropathy in patients with type 1 diabetes mellitus.
19244313 2009 Serotonin induces Rho/ROCK-dependent activation of Smads 1/5/8 in pulmonary artery smooth muscle cells.
19211612 2009 A new nonsense mutation of SMAD8 associated with pulmonary arterial hypertension.
19018011 2008 Holding their own: the noncanonical roles of Smad proteins.
18775991 2008 Endoglin promotes transforming growth factor beta-mediated Smad 1/5/8 signaling and inhibits endothelial cell migration through its association with GIPC.
18684712 2009 Constitutively activated ALK2 and increased SMAD1/5 cooperatively induce bone morphogenetic protein signaling in fibrodysplasia ossificans progressiva.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18393632 2008 Control of early fate decisions in human ES cells by distinct states of TGFbeta pathway activity.
18310319 2008 Tumor cell cycle arrest induced by shear stress: Roles of integrins and Smad.
18298822 2008 Association study in the 5q31-32 linkage region for schizophrenia using pooled DNA genotyping.
17847004 2007 Common variants in the BMP2, BMP4, and HJV genes of the hepcidin regulation pathway modulate HFE hemochromatosis penetrance.
17359969 2007 Antisense targeting of TGF-beta1 augments BMP-induced upregulation of osteopontin, type I collagen and Cbfa1 in human Saos-2 cells.
17356069 2007 Endofin acts as a Smad anchor for receptor activation in BMP signaling.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16436528 2006 Mutual regulation of follicle-stimulating hormone signaling and bone morphogenetic protein system in human granulosa cells.
16247476 2006 Bone morphogenetic protein 2 stimulation of tumor growth involves the activation of Smad-1/5.
16243555 2006 Homology modeling of the DNA-binding domain of human Smad5: a molecular model for inhibitor design.
15877825 2005 BMP-6 inhibits growth of mature human B cells; induction of Smad phosphorylation and upregulation of Id1.
15647271 2005 The integral inner nuclear membrane protein MAN1 physically interacts with the R-Smad proteins to repress signaling by the transforming growth factor-{beta} superfamily of cytokines.
15621726 2004 Bone morphogenetic proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15246821 2004 BMP signaling initiates a neural crest differentiation program in embryonic rat CNS stem cells.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15107829 2004 Suv39h histone methyltransferases interact with Smads and cooperate in BMP-induced repression.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14687659 2004 Signal transduction of bone morphogenetic protein receptors.
14670176 SMAD5 gene expression, rearrangements, copy number, and amplification at fragile site FRA5C in human hepatocellular carcinoma.
12849988 2003 Mitochondrial localization of Smad5 in a human chondrogenic cell line.
12649288 2003 Inactivation of menin, the product of the multiple endocrine neoplasia type 1 gene, inhibits the commitment of multipotential mesenchymal stem cells into the osteoblast lineage.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473652 2003 Up-regulated Smad5 mediates apoptosis of gastric epithelial cells induced by Helicobacter pylori infection.
12370310 2002 Identification of mZnf8, a mouse Krüppel-like transcriptional repressor, as a novel nuclear interaction partner of Smad1.
12064918 Inhibition of Smad5 in human hematopoietic progenitors blocks erythroid differentiation induced by BMP4.
12060751 2002 Integration of Runx and Smad regulatory signals at transcriptionally active subnuclear sites.
11451570 2001 Studying TGF-beta superfamily signaling by knockouts and knockins.
11451566 2001 The transcriptional role of Smads and FAST (FoxH1) in TGFbeta and activin signalling.
11278410 2001 Filamin associates with Smads and regulates transforming growth factor-beta signaling.
11278251 2001 Smurf1 interacts with transforming growth factor-beta type I receptor through Smad7 and induces receptor degradation.
11163184 2000 Negative regulation of BMP/Smad signaling by Tob in osteoblasts.
11121043 2000 Ski represses bone morphogenic protein signaling in Xenopus and mammalian cells.
10708949 TGF-beta signaling by Smad proteins.
10708948 The Smad pathway.
10652350 2000 Smad and AML proteins synergistically confer transforming growth factor beta1 responsiveness to human germ-line IgA genes.
10647776 Remarkable versatility of Smad proteins in the nucleus of transforming growth factor-beta activated cells.
10583507 1999 Smad8B, a Smad8 splice variant lacking the SSXS site that inhibits Smad8-mediated signalling.
10504300 1999 Characterization of bone morphogenetic protein-6 signaling pathways in osteoblast differentiation.
10400677 1999 SIP1, a novel zinc finger/homeodomain repressor, interacts with Smad proteins and binds to 5'-CACCT sequences in candidate target genes.
10049768 1999 An antisense transcript to SMAD5 expressed in fetal and tumor tissues.
9759503 1998 TGF-beta signal transduction.
9748228 1998 Specific activation of Smad1 signaling pathways by the BMP7 type I receptor, ALK2.
9484787 1998 hSmad5 gene, a human hSmad family member: its full length cDNA, genomic structure, promoter region and mutation analysis in human tumors.
9442019 1998 Smad5 and DPC4 are key molecules in mediating BMP-2-induced osteoblastic differentiation of the pluripotent mesenchymal precursor cell line C2C12.
9436979 1998 Smad6 inhibits BMP/Smad1 signaling by specifically competing with the Smad4 tumor suppressor.
9288787 1997 Localization of SMAD5 and its evaluation as a candidate myeloid tumor suppressor.
9264367 1997 Smad5, a tumor suppressor candidate at 5q31.1, is hemizygously lost and not mutated in the retained allele in human leukemia cell line HL60.
8673135 1996 Mad-related genes in the human.