Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.59
PubTator Score 1.34

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q5VYV7 Q05CG2 Q05CT9
Symbols C20orf94
bA204H22.1
bA254M13.1
dJ1099D15.3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
24412650 HIV-1 Vpr interacts with TSPYL1 and C20orf94 subunits of the SLX4 complex in Vpr-expressing THP-1 cells
24045615 The association of SLX4IP deletion with male sex suggest that differential illegitimate V(D)J-mediated recombination events contribute to the higher incidence rates of childhood acute lymphoblastic leukemia in boys compared with girls.
21555518 C20orf94 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MASKKFAVKCGNFAVLVDLHILPQGSNKDTSWFSEQKKEEVCLLLKETIDSRVQEYLEVRKQHRPSNAEF      1 - 70
TRSNPLSLKGYGFQITAYFLKRGIRLRCIRSTQNAELCVFPDRFVVCVSQLAFSRDLLASQNEDLTERVL     71 - 140
HGVSDYFAECAESSLPPSAKLRRNALKEIVKRTETKSSVTSKSQTRRDTVETSSDSVIAEIARRRNDGQA    141 - 210
SSSPPSESMGQAKDSIKAAESHWGLPVQKLEKVNQTQPEDTSGQQKPHPGERLKTGLLSRSPVCSCESAS    211 - 280
PCPKQSPRVAKTQQKRRNCSSAEDFDHHGRVSLGSDRLVPREIIVEKSKAVRVLPASELSDPGLLLKQDL    281 - 350
AKTTSKEELHVLESLSSRHLMKNNPGQAQQTGLATNTERLSTIQNSPTKKRKKYERGH                351 - 408
//

Text Mined References (10)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
24045615 2014 Frequent and sex-biased deletion of SLX4IP by illegitimate V(D)J-mediated recombination in childhood acute lymphoblastic leukemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19596235 2009 Mammalian BTBD12/SLX4 assembles a Holliday junction resolvase and is required for DNA repair.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.