Property Summary

NCBI Gene PubMed Count 30
PubMed Score 236.10
PubTator Score 58.28

Knowledge Summary

Patent (21,845)

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 1.200 6.1e-05
astrocytic glioma -1.500 2.9e-02
ependymoma -1.500 2.4e-02
oligodendroglioma -1.300 3.7e-02
psoriasis 1.200 3.9e-04
glioblastoma -1.500 1.1e-02
medulloblastoma, large-cell -1.200 1.8e-05
primitive neuroectodermal tumor -1.100 4.7e-04
Amyotrophic Lateral Sclerosis 1.074 3.6e-07
acute quadriplegic myopathy 1.632 9.1e-08
non-small cell lung cancer -1.253 8.6e-14
intraductal papillary-mucinous neoplasm ... 1.200 2.4e-02
Hydrolethalus syndrome 1.257 3.9e-02
lung cancer -1.400 4.6e-04
adult high grade glioma -1.800 2.4e-06
lung adenocarcinoma -1.056 5.3e-04
spina bifida -1.765 4.5e-02
progressive supranuclear palsy -1.300 1.9e-02
invasive ductal carcinoma -1.400 1.1e-04
ovarian cancer -2.400 7.4e-08
dermatomyositis 1.700 1.8e-04

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (9)

PMID Text
26094769 SLK interacts with Tpr and alpha-actinin-4 in cells, and these protein-protein interactions may control the subcellular localization and the biological activity of SLK.
24958772 SLK activated ERMs, together with Galphai, are critical for the correct localization of LGN-NuMA force generator complexes and hence for proper spindle orientation.
23985322 The fact that SLK (LOSK) phosphorylates only a minor isoform 1A of p150(Glued) suggests that transport and microtubule-organizing functions of dynactin are distinctly divided between the two isoforms
23209304 It was shown that lymphocyte-oriented and STE20 kinase were sufficient to restrict ezrin function to the apical domain. Both kinases were enriched in microvilli and locally activated there.
19525980 Studies define an interaction between Neu and SLK signaling in the regulation of cancer cell motility.
18287541 Protein kinase LOSK is required for radial microtubule organization and for the proper localization of Golgi complex in various cell types.
17321610 we show that a novel isoform of SPS1-related proline alanine-rich kinase (SPAK/STE20) is involved in this inflammatory signaling cascade
16837460 v-Src-dependent down-regulation of the Ste20-like kinase SLK through casein kinase II.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSFFNFRKIFKLGSEKKKKQYEHVKRDLNPEDFWEIIGELGDGAFGKVYKAQNKETSVLAAAKVIDTKSE      1 - 70
EELEDYMVEIDILASCDHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVMLELERPLTESQIQVVCKQTL     71 - 140
DALNYLHDNKIIHRDLKAGNILFTLDGDIKLADFGVSAKNTRTIQRRDSFIGTPYWMAPEVVMCETSKDR    141 - 210
PYDYKADVWSLGITLIEMAEIEPPHHELNPMRVLLKIAKSEPPTLAQPSRWSSNFKDFLKKCLEKNVDAR    211 - 280
WTTSQLLQHPFVTVDSNKPIRELIAEAKAEVTEEVEDGKEEDEEEETENSLPIPASKRASSDLSIASSEE    281 - 350
DKLSQNACILESVSEKTERSNSEDKLNSKILNEKPTTDEPEKAVEDINEHITDAQLEAMTELHDRTAVIK    351 - 420
ENEREKRPKLENLPDTEDQETVDINSVSEGKENNIMITLETNIEHNLKSEEEKDQEKQQMFENKLIKSEE    421 - 490
IKDTILQTVDLVSQETGEKEANIQAVDSEVGLTKEDTQEKLGEDDKTQKDVISNTSDVIGTCEAADVAQK    491 - 560
VDEDSAEDTQSNDGKEVVEVGQKLINKPMVGPEAGGTKEVPIKEIVEMNEIEEGKNKEQAINSSENIMDI    561 - 630
NEEPGTTEGEEITESSSTEEMEVRSVVADTDQKALGSEVQDASKVTTQIDKEKKEIPVSIKKEPEVTVVS    631 - 700
QPTEPQPVLIPSININSDSGENKEEIGSLSKTETILPPESENPKENDNDSGTGSTADTSSIDLNLSISSF    701 - 770
LSKTKDSGSISLQETRRQKKTLKKTRKFIVDGVEVSVTTSKIVTDSDSKTEELRFLRRQELRELRFLQKE    771 - 840
EQRAQQQLNSKLQQQREQIFRRFEQEMMSKKRQYDQEIENLEKQQKQTIERLEQEHTNRLRDEAKRIKGE    841 - 910
QEKELSKFQNMLKNRKKEVINEVEKAPKELRKELMKRRKEELAQSQHAQEQEFVQKQQQELDGSLKKIIQ    911 - 980
QQKAELANIERECLNNKQQLMRAREAAIWELEERHLQEKHQLLKQQLKDQYFMQRHQLLKRHEKETEQMQ    981 - 1050
RYNQRLIEELKNRQTQERARLPKIQRSEAKTRMAMFKKSLRINSTATPDQDRDKIKQFAAQEEKRQKNER   1051 - 1120
MAQHQKHENQMRDLQLQCEANVRELHQLQNEKCHLLVEHETQKLKELDEEHSQELKEWREKLRPRKKTLE   1121 - 1190
EEFARKLQEQEVFFKMTGESECLNPSTQSRISKFYPIPSLHSTGS                            1191 - 1235
//

Text Mined References (40)

PMID Year Title
26818812 2016 SLK/LOSK kinase regulates cell motility independently of microtubule organization and Golgi polarization.
26094769 2015 Identification of Tpr and ?-actinin-4 as two novel SLK-interacting proteins.
25882817 2015 Recruitment and activation of SLK at the leading edge of migrating cells requires Src family kinase activity and the LIM-only protein 4.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24958772 2014 SLK-dependent activation of ERMs controls LGN-NuMA localization and spindle orientation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23985322 2013 Ste20-like protein kinase SLK (LOSK) regulates microtubule organization by targeting dynactin to the centrosome.
23209304 2012 Local phosphocycling mediated by LOK/SLK restricts ezrin function to the apical aspect of epithelial cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128389 2013 SLK-mediated phosphorylation of paxillin is required for focal adhesion turnover and cell migration.
22203681 2012 Regulation of the Ste20-like kinase, SLK: involvement of activation segment phosphorylation.
21460842 2011 A genome-wide association study identifies three loci associated with susceptibility to uterine fibroids.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19525980 2009 The Ste20-like kinase SLK is required for ErbB2-driven breast cancer cell motility.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18287541 2008 Ste20-related protein kinase LOSK (SLK) controls microtubule radial array in interphase.
18239682 2008 Activation segment dimerization: a mechanism for kinase autophosphorylation of non-consensus sites.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17321610 2007 Cloning and characterization of a new intestinal inflammation-associated colonic epithelial Ste20-related protein kinase isoform.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16837460 2006 v-Src-dependent down-regulation of the Ste20-like kinase SLK by casein kinase II.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
11316611 2001 The Ste20 group kinases as regulators of MAP kinase cascades.
11149944 2001 Serological detection of cutaneous T-cell lymphoma-associated antigens.
10699464 2000 Molecular cloning and characterization of a novel human STE20-like kinase, hSLK.
10611247 2000 Caspase 3 cleavage of the Ste20-related kinase SLK releases and activates an apoptosis-inducing kinase domain and an actin-disassembling region.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.
3526554 1986 A yeast gene that is essential for release from glucose repression encodes a protein kinase.