Property Summary

NCBI Gene PubMed Count 115
PubMed Score 125.21
PubTator Score 213.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.833 6.6e-04
non-small cell lung cancer 1.013 3.0e-05
colon cancer 3.300 4.7e-02
lung cancer 1.800 2.4e-04
active Crohn's disease 1.561 4.6e-02
active ulcerative colitis 3.667 4.0e-03
pancreatic cancer 1.500 1.0e-02
cystic fibrosis -1.300 6.1e-04

 GWAS Trait (1)

Gene RIF (106)

PMID Text
26474710 OATP1B1- and OATP1B3-humanized mice can be used as in vivo tools to assess and possibly predict clinically relevant DDIs.
26409184 Results identified interethnic differences of genetic variations of the SLCO1B1, SLCO1B3, and SLCO2B1 genes in Korean population compared with other ethnic groups.
26383540 transport of CPR I mediated by OATP1B1 and OATP1B3 and the transport of CPR III mediated by OATPs 1B1, 1B3 and 2B1 is time-dependent, can be saturated and inhibited
26267044 Carriers of a T allele of SLCO1B3-rs4149117 were less sensitive to thrombocytopenia than the homozygotes for the G allele
26264344 Cancer-type Organic Anion Transporting Polypeptide 1B3: Current Knowledge of the Gene Structure, Expression Profile, Functional Implications and Future Perspectives
26191226 Down-regulation of OATP1B1/3 proteins may contribute to pathogenesis of jaundice accompanying advanced cholestatic liver diseases.
26146841 SLCO1B1 and SLCO1B3 polymorphisms contributed to an increased risk of neonatal hyperbilirubinemia.
26134461 Data suggest that OATP1B3 facilitates transport of the shellfish toxin okadaic acid into hepatocytes.
25578040 Data suggest that expression of SLCO1B1 and SLCO1B3 in hepatocytes can be regulated by dietary factors; expression of SLCO1B1 is up-regulated by anthocyanins/anthocyanin glycosides; expression of SLCO1B3 is down-regulated by these fruit pigments.
25456266 HEK293-OATP1B3 cells are resistant to microcystin-LR induced anoikis.
25391605 UGT1A1, SLCO1B1 and SLCO1B3 polymorphisms become risk factors in neonates showing 10% or greater body weight loss during the neonatal period. Inadequate feeding may increase the bilirubin burden and cause apparent hyperbilirubinemia in neonates.
25345542 Our results indicated that OATP1B3 may play an important role in the transport of glycocholic acid and glycochenodeoxycholic acid in the human placenta.
25200870 studies elucidate a novel indirect inhibitory mechanism affecting hepatic uptake mediated by OATP1B3, and provide new insights into predicting OATP-mediated drug interactions between OATP substrates and kinase modulator drugs/endogenous compounds
25173835 expression elevated in indocyanine green-accumulated hepatocellular carcinoma
25056761 SLCO1B3 699GG and 344TT genotypes are associated with non-response to IM, while ABCA3 4548-91 CC/CA genotypes are related to poor CMR in CML patients treated with standard-dose imatinib.
24989890 A pronounced OATP1B1 and comparatively low OATP1B3 protein expression in the investigated hepatocyte lot.
24946283 OATP1B3 was confirmed as the most important transporter mediating hepatocellular carcinoma enhancement in gadoxetic acid-enhanced magnetic resonance imaging.
24855184 The expression of OATP1B1 and -1B3 in the humanized models did not significantly alter liver or plasma concentrations of rosuvastatin.
24825069 human OATP1B1, OATP1B3 and OATP1A2 can transport docetaxel in vivo.
24762081 The genotypes of the two other SLCOs,SLCO1B3 and SLCO2B1, did not show any association with bladder cancer susceptibility
24740327 Data indicate that HEK-293T cells expressing liver specific organic anion transporter peptides OATP1B1 and OATP1B3 undergo apoptosis upon nodularin treatment.
24628404 Report regulation of OATP1B3-mediated telmisartan uptake in cultured hepatocytes.
24357722 SLCO1B3 expression and promoter activity are modulated by COL7A1 in tumor keratinocytes isolated from recessive dystrophic epidermolysis bullosa.
24194513 Knockin of OATP1B1 or OATP1B3 partially restored control clearance.
24150606 These data provide evidence that the drug transporter OATP1B3 functions as a determinant of the insulinotropic effect of glibenclamide on the tissue level.
23924606 The transcription of cancer-specific OATP1B3 is regulated during hypoxia through a commonly utilized pathway involving HIF-1alpha.
23886114 In vitro OATP1B1 and OATP1B3 inhibition is associated with observations of benign clinical unconjugated hyperbilirubinemia.
23812637 Cancer-type - OATP1B3 is capable of transporting its substrates into cancer cells. Its mRNA expression is regulated by DNA methylation-dependent gene silencing involving MBD2.
23782748 The patients with tumors showing high expression levels of at least one of OATP1B3 and CTR1 had potentially longer disease-free survival.
23670789 Treatment with SD rifampin, which inhibits the OATP1B1/3 transporter system, did not substantially influence the SD pharmacokinetics of anacetrapib.
23394475 CYP3A5*3 polymorphism was associated with imatinib efficacy while the SNP SLCO1B3 (T334G) was not associated with the response to imatinib treatment in Egyptian patients with CML in chronic phase.
23352438 Data indicate that SLCO1B3 knockdown reduced cell size and 3-dimensional spheroid volume.
23340295 These findings signify a unique role for OATP1B1 and OATP1B3 in the elimination of sorafenib-glucuronide and suggest a role for these transporters in the in vivo handling of glucuronic acid conjugates of drugs.
23215050 Colon and pancreatic cancer cells express variant forms of OATP1B3.
23188068 There was no significant association of the SLCO1B3 polymorphisms with docetaxel clearance or neutropenia.
22771883 Genetic polymorphisms of OATP1B1 are signal confounders in gadoxetic acid-enhanced liver MR imaging. No pharmacokinetic characteristics of gadoxetic acid were influenced by genetic polymorphisms of OATP1B1 and OATP1B3.
22695893 there was no remarkable difference in any pharmacokinetic parameters of olmesartan between subjects with and without any major haplotypes in the three transporter genes we tested- SLCO1B1, SLCO1B3 and ABCC2
22580719 The presence of the rs2117032 polymorphism of SLCO1B3 seemed to provide protection from hyperbilirubinemia.
22352740 Site-directed mutagenesis of three key residues in OATP1B1 transmembrane helices 1 and 10, and extracellular loop 6, to the corresponding residues in OATP1B3, resulted in a gain of CCK-8 transport by OATP1B1.
22326869 Isoform specific mRNA quantification showed that the Ct-OATP1B3 mRNA level was strikingly higher than that of Lt-OATP1B3 mRNA in human cancer tissues.
22240838 Cyclosporine A has a long-lasting inhibitory effect on OATP1B1 and OATP1B3.
22232210 Data show that Rotor syndrome was linked to mutations predicted to cause complete and simultaneous deficiencies of the organic anion transporting polypeptides OATP1B1 and OATP1B3.
22203093 The expression of OATP1A2 and OATP1B3 in placenta decreased in, and may be involved in the pathophysiology of, intrahepatic cholestasis of pregnancy. OATP1B3 was localized to the vasculo-syncytial membrane of syncytiotrophoblasts.
22147445 Thirty-six variations of OATP1B3 were identified in the Korean population, consisting of nine variations in the 5'-upstream region, ten in the exon regions, and seventeen in the intron regions.
22136368 genotype and haplotype distributions are highly variable among populations of the same self-reported colour and geographical region
21995462 Influence of SLCO1B3 haplotype-tag SNPs on docetaxel disposition in Chinese nasopharyngeal cancer patients
21849517 Digoxin inhibited the uptake of probe substrates of OATP1B1 (IC(50) of 47 muM), OATP1B3 (IC(50) > 8.1 muM), and OATP2B1 (IC(50) > 300 muM), but not OATP1A2 in transfected cell lines.
21787759 This study demonstrated that plated primary human hepatocytes are useful as an in vitro model for OATP1B1/1B3-mediated uptake studies, but the culture time may substantially change the uptake kinetics.
21719246 Data suggest OATP1B1 and OATP1B3 are high-affinity paclitaxel transporters expressed in ovarian cancer cell lines and tumor tissues (or when expressed as recombinant proteins in Xenopus laevis oocytes).
21691816 we studied a series of hepatocellular carcinomas from livers that underwent liver transplantation and correlated the expression of OATP 1B1/1B3 with morphological features
21626360 immunohistochemical expression of OATP8 significantly decreases during multistep hepatocarcinogenesis
21615622 SLCO1B3 expression, rather than CTNNB1 mutation, is the critical determinant of intratumoral cholestasis.
21606417 Genetic variants of SLCO1B3 may function as pharmacogenomic determinants of resistance to androgen deprivation therapy in prostate cancer.
21278621 OATP1B3 polymorphisms that result in altered expression, substrate specificity, and pH-dependent activity may be of potential relevance to hepatic clearance of substrate drugs in vivo.
21266523 Six SLCO genes were highly expressed in castration resistane prostate cancer metastases versus untreated prostate cancer, including SLCO1B3 and SLCO2B.
21256917 Data indicate that hydroxyurea transport and cellular uptake by OATP1B3 is time- and temperature-dependent.
21212528 These results suggested that the SLCO1B3 334T>G polymorphism could have a significant impact on the intracellular concentration of imatinib in leukocytes as a promising biomarker for personalized treatment of chronic myeloid leukemia patients.
20877131 Forty one nucleotide sequence variants leading to nine major haplotypes in the SLCO1B3 were identified in caucasian Canadians.
20877131 Observational study of genotype prevalence. (HuGE Navigator)
20720558 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20660695 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20639394 Genetic variations of SLCO1B3 and UGT1A1 is associated serum bilirubin levels in Korean population.
20639394 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20635135 data suggest that among the many known transporters common variations of PXR, SLCO1A2, SLCO1B1, SLCO1B3, and SLCO2B1 do not contribute to breast carcinogenesis
20635135 Observational study of gene-disease association. (HuGE Navigator)
20615467 OATP1B3 is one of the transporters contributing to the supply of the estrogen precursor estrone-3-sulfate to estrogen-dependent breast cancer cells.
20560925 Is present in high frequencies in the finnish population
20560925 Observational study of genotype prevalence. (HuGE Navigator)
20212519 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20130966 DNA methylation-dependent gene silencing is at least partly involved in the regulation of OATP1B3 expression in cancer/immortalized cell lines.
20051929 Antiretroviral protease inhibitors, but not non-nucleoside reverse transcriptase inhibitors, are substrates for OATP1A2, OATP1B1 and OATP1B3.
19890249 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19620935 Observational study of gene-disease association. (HuGE Navigator)
19442037 In this review, organic anion transporting polypeptide (OATP)1B3 is an uptake transporter specifically expressed in the liver, and is considered important for drugs, particularly as its pharmacological target organ is the liver.
19419973 SLC01B3 variants contribute to mild unconjugated hyperbilirubinemia.
19419973 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19228751 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19122334 The insert-variant allele of the SLCO1B3 gene may increase the concentration-to-dose ratio of digoxin in hemodialysis patients.
19122334 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19074900 OATP1B3 overexpression in colorectal cancer cells may provide a survival advantage by altering p53-dependent pathways.
18695635 SLCO1B3 polymorphism significantly influences plasma mycophenolic acid glucuronide pharmacokinetics in Japanese renal transplant recipients.
18690707 identificaction of three amino acid residues (Y537, S545, and T550) in TM10 of organic anion transporting polypeptide 1B3 that are important for cholecystokinin octapeptide transport.
18537956 A polymorphism in a transporter, in SLCO1B3, that increases testosterone import is associated with a shorter time to androgen independence in patients with prostate cancer who are treated with ADT.
18537956 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18519758 The common SLCO1B3 GG/AA haplotype is associated with impaired testosterone transport and improved survival in patients with prostatic cancer.
18509328 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18509327 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18321482 Pregnane X receptor ligands, by inhibiting or stimulating OATP1B3-mediated uptake, can lead to drug-drug interactions at the transporter level.
18314419 Alterations of OATP1BB3 function by oral antidiabetic drugs have to be considered as potential mechanisms underlying drug-drug interactions.
18294295 SNPs in and SLCO1B3 may predict the risk of leukopenia/neutropenia induced by docetaxel chemotherapy.
18294295 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18180273 A set of double transfectants expressing OATP1B3 combined with OAT1B1 can be used as a tool for rapid identification of hepatic uptake and efflux transporters of many organic anions that are substrates of OATP1B1 or OATP1B3.
18082941 Performed transport assays in OATP1B3-expressing cells as a method of indentifying novel antineoplastic agents.
17906856 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17760952 LST-2 overexpression is associated with a hormone-dependent growth mechanism of the breast cancer
17496208 Bosentan uptake into Chinese hamster ovary cells expressing human OATP1B1 or OATP1B3, and was efficiently inhibited by cyclosporin A, rifampicin, and to a lesser extent by sildenafil.
17412826 these results indicate that OATP1B3/OATP-8 and OATP1B1/OATP-C most likely function as bidirectional facilitated diffusion transporters and that GSH is not a substrate or activator of their transport activity.
17186002 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16877380 although both OATP-C/1B1 and OATP8/1B3 are highly expressed, and able to transport bile acids, their mechanisms of action are different
16741617 the transcription of the LST-2 gene is regulated by three transcription factors, FXR, HNF1alpha, and HNF3beta.
16534140 OATP1B3 play important roles in CDCA uptake into the liver.
15226676 The functional consequences of three polymorphisms and one artificial mutation include differences in the localization and in hepatocellular transport of several OATP1B3 proteins.
14739090 HNF3beta represses transcription of the OATP8 but not the OATP-C gene, providing a mechanism for reduced expression of OATP8 in hepatocellular carcinoma
12055601 Human organic anion transporting polypeptide 8 promoter is transactivated by the farnesoid X receptor/bile acid receptor.

AA Sequence

MDQHQHLNKTAESASSEKKKTRRCNGFKMFLAALSFSYIAKALGGIIMKISITQIERRFDISSSLAGLID      1 - 70
GSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCLLMGTGSILTSLPHFFMGYYRYSKETHINPSENSTSSLS     71 - 140
TCLINQTLSFNGTSPEIVEKDCVKESGSHMWIYVFMGNMLRGIGETPIVPLGISYIDDFAKEGHSSLYLG    141 - 210
SLNAIGMIGPVIGFALGSLFAKMYVDIGYVDLSTIRITPKDSRWVGAWWLGFLVSGLFSIISSIPFFFLP    211 - 280
KNPNKPQKERKISLSLHVLKTNDDRNQTANLTNQGKNVTKNVTGFFQSLKSILTNPLYVIFLLLTLLQVS    281 - 350
SFIGSFTYVFKYMEQQYGQSASHANFLLGIITIPTVATGMFLGGFIIKKFKLSLVGIAKFSFLTSMISFL    351 - 420
FQLLYFPLICESKSVAGLTLTYDGNNSVASHVDVPLSYCNSECNCDESQWEPVCGNNGITYLSPCLAGCK    421 - 490
SSSGIKKHTVFYNCSCVEVTGLQNRNYSAHLGECPRDNTCTRKFFIYVAIQVINSLFSATGGTTFILLTV    491 - 560
KIVQPELKALAMGFQSMVIRTLGGILAPIYFGALIDKTCMKWSTNSCGAQGACRIYNSVFFGRVYLGLSI    561 - 630
ALRFPALVLYIVFIFAMKKKFQGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAA    631 - 700
AN                                                                        701 - 702
//

Text Mined References (117)

PMID Year Title
26474710 2015 Preclinical Mouse Models To Study Human OATP1B1- and OATP1B3-Mediated Drug-Drug Interactions in Vivo.
26409184 2015 Comparison of genetic variations of the SLCO1B1, SLCO1B3, and SLCO2B1 genes among five ethnic groups.
26383540 2016 Organic anion transporting polypeptide (OATP)-mediated transport of coproporphyrins I and III.
26267044 2015 Polymorphisms in SLCO1B3 and NR1I2 as genetic determinants of hematotoxicity of carboplatin and paclitaxel combination.
26264344 2015 Cancer-type Organic Anion Transporting Polypeptide 1B3: Current Knowledge of the Gene Structure, Expression Profile, Functional Implications and Future Perspectives.
26191226 2015 Down-regulation of OATP1B proteins correlates with hyperbilirubinemia in advanced cholestasis.
26146841 2015 Multiple Genetic Modifiers of Bilirubin Metabolism Involvement in Significant Neonatal Hyperbilirubinemia in Patients of Chinese Descent.
26134461 2015 Okadaic acid is taken-up into the cells mediated by human hepatocytes transporter OATP1B3.
25578040 2015 Effects of anthocyans on the expression of organic anion transporting polypeptides (SLCOs/OATPs) in primary human hepatocytes.
25456266 2014 Microcystin-LR induces anoikis resistance to the hepatocyte uptake transporter OATP1B3-expressing cell lines.
25391605 2015 Association of neonatal hyperbilirubinemia in breast-fed infants with UGT1A1 or SLCOs polymorphisms.
25345542 2015 Role of OATP1B3 in the transport of bile acids assessed using first-trimester trophoblasts.
25200870 2014 Novel mechanism of impaired function of organic anion-transporting polypeptide 1B3 in human hepatocytes: post-translational regulation of OATP1B3 by protein kinase C activation.
25173835 2015 Expression of indocyanine green-related transporters in hepatocellular carcinoma.
25056761 2015 Relationship between SLCO1B3 and ABCA3 polymorphisms and imatinib response in chronic myeloid leukemia patients.
24989890 2014 Prediction of organic anion-transporting polypeptide 1B1- and 1B3-mediated hepatic uptake of statins based on transporter protein expression and activity data.
24946283 2014 OATP1B3 expression is strongly associated with Wnt/?-catenin signalling and represents the transporter of gadoxetic acid in hepatocellular carcinoma.
24855184 2014 Evaluation of organic anion transporting polypeptide 1B1 and 1B3 humanized mice as a translational model to study the pharmacokinetics of statins.
24825069 2015 Human OATP1B1, OATP1B3 and OATP1A2 can mediate the in vivo uptake and clearance of docetaxel.
24762081 2014 SLCO1B1, SLCO2B1, and SLCO1B3 polymorphisms and susceptibility to bladder cancer risk.
24740327 2014 Introduction of aromatic ring-containing substituents in cyclic nucleotides is associated with inhibition of toxin uptake by the hepatocyte transporters OATP 1B1 and 1B3.
24628404 2014 Culture duration-, donor-, and medium-dependent changes in OATP1B3-mediated telmisartan uptake in human hepatocytes.
24357722 2014 Type VII collagen regulates expression of OATP1B3, promotes front-to-rear polarity and increases structural organisation in 3D spheroid cultures of RDEB tumour keratinocytes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24194513 2014 Utility of Oatp1a/1b-knockout and OATP1B1/3-humanized mice in the study of OATP-mediated pharmacokinetics and tissue distribution: case studies with pravastatin, atorvastatin, simvastatin, and carboxydichlorofluorescein.
24150606 2014 OATP1B3 is expressed in pancreatic ?-islet cells and enhances the insulinotropic effect of the sulfonylurea derivative glibenclamide.
23924606 2013 Role of hypoxia inducible factor-1? in the regulation of the cancer-specific variant of organic anion transporting polypeptide 1B3 (OATP1B3), in colon and pancreatic cancer.
23886114 2014 In vitro OATP1B1 and OATP1B3 inhibition is associated with observations of benign clinical unconjugated hyperbilirubinemia.
23812637 2013 Epigenetic regulation of organic anion transporting polypeptide 1B3 in cancer cell lines.
23782748 2013 Prognostic value of organic anion transporting polypeptide 1B3 and copper transporter 1 expression in endometrial cancer patients treated with paclitaxel and carboplatin.
23670789 2013 Effects of Rifampin, a potent inducer of drug-metabolizing enzymes and an inhibitor of OATP1B1/3 transport, on the single dose pharmacokinetics of anacetrapib.
23394475 2013 Do SLCO1B3 (T334G) and CYP3A5*3 polymorphisms affect response in Egyptian chronic myeloid leukemia patients receiving imatinib therapy?
23371916 2013 A genome-wide association study for serum bilirubin levels and gene-environment interaction in a Chinese population.
23352438 2013 An in vivo hypoxia metagene identifies the novel hypoxia inducible factor target gene SLCO1B3.
23340295 2013 Contribution of OATP1B1 and OATP1B3 to the disposition of sorafenib and sorafenib-glucuronide.
23215050 2013 A cancer-specific variant of the SLCO1B3 gene encodes a novel human organic anion transporting polypeptide 1B3 (OATP1B3) localized mainly in the cytoplasm of colon and pancreatic cancer cells.
23188068 2013 The relationship of polymorphisms in ABCC2 and SLCO1B3 with docetaxel pharmacokinetics and neutropenia: CALGB 60805 (Alliance).
22771883 2012 Visualization of hepatic uptake transporter function in healthy subjects by using gadoxetic acid-enhanced MR imaging.
22695893 2012 Association study of genetic polymorphisms of drug transporters, SLCO1B1, SLCO1B3 and ABCC2, in African-Americans, Hispanics and Caucasians and olmesartan exposure.
22580719 2012 UGT1A1, SLCO1B1, and SLCO1B3 polymorphisms vs. neonatal hyperbilirubinemia: is there an association?
22352740 2012 Interaction of three regiospecific amino acid residues is required for OATP1B1 gain of OATP1B3 substrate specificity.
22326869 2012 Identification of a new organic anion transporting polypeptide 1B3 mRNA isoform primarily expressed in human cancerous tissues and cells.
22240838 2012 Long-lasting inhibitory effects of cyclosporin A, but not tacrolimus, on OATP1B1- and OATP1B3-mediated uptake.
22232210 2012 Complete OATP1B1 and OATP1B3 deficiency causes human Rotor syndrome by interrupting conjugated bilirubin reuptake into the liver.
22227166 2012 The association of the UGT1A8, SLCO1B3 and ABCC2/ABCG2 genetic polymorphisms with the pharmacokinetics of mycophenolic acid and its phenolic glucuronide metabolite in Chinese individuals.
22221095 2012 Contribution of organic anion transporting polypeptide (OATP) 1B1 and OATP1B3 to hepatic uptake of nateglinide, and the prediction of drug-drug interactions via these transporters.
22203093 2012 Alteration in placental expression of bile acids transporters OATP1A2, OATP1B1, OATP1B3 in intrahepatic cholestasis of pregnancy.
22185815 2012 Genetic polymorphisms of OATP transporters and their impact on intestinal absorption and hepatic disposition of drugs.
22147445 2012 Functional consequences of genetic variations in the human organic anion transporting polypeptide 1B3 (OATP1B3) in the Korean population.
22136368 2012 Influence of genomic ancestry on the distribution of SLCO1B1, SLCO1B3 and ABCB1 gene polymorphisms among Brazilians.
21995462 2012 Influence of SLCO1B3 haplotype-tag SNPs on docetaxel disposition in Chinese nasopharyngeal cancer patients.
21849517 2011 Digoxin is not a substrate for organic anion-transporting polypeptide transporters OATP1A2, OATP1B1, OATP1B3, and OATP2B1 but is a substrate for a sodium-dependent transporter expressed in HEK293 cells.
21787759 2011 OATP1B1/1B3 activity in plated primary human hepatocytes over time in culture.
21719246 2011 Expression of organic anion-transporting polypeptides 1B1 and 1B3 in ovarian cancer cells: relevance for paclitaxel transport.
21691816 2011 OATP 1B1/1B3 expression in hepatocellular carcinomas treated with orthotopic liver transplantation.
21626360 2011 The uptake transporter OATP8 expression decreases during multistep hepatocarcinogenesis: correlation with gadoxetic acid enhanced MR imaging.
21615622 2011 Expression of SLCO1B3 is associated with intratumoral cholestasis and CTNNB1 mutations in hepatocellular carcinoma.
21606417 2011 SLCO2B1 and SLCO1B3 may determine time to progression for patients receiving androgen deprivation therapy for prostate cancer.
21278621 2011 Identification of novel functional organic anion-transporting polypeptide 1B3 polymorphisms and assessment of substrate specificity.
21266523 2011 Expression of SLCO transport genes in castration-resistant prostate cancer and impact of genetic variation in SLCO1B3 and SLCO2B1 on prostate cancer outcomes.
21256917 2011 Transcellular movement of hydroxyurea is mediated by specific solute carrier transporters.
21212528 2011 Association of SLCO1B3 polymorphism with intracellular accumulation of imatinib in leukocytes in patients with chronic myeloid leukemia.
20877131 2010 Organic anion transporting polypeptide 1B1 (OATP1B1) and OATP1B3: genetic variability and haplotype analysis in white Canadians.
20720558 2010 Influence of CYP3A5 and drug transporter polymorphisms on imatinib trough concentration and clinical response among patients with chronic phase chronic myeloid leukemia.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20660695 2010 Effects of tuberculosis, race, and human gene SLCO1B1 polymorphisms on rifampin concentrations.
20639394 2010 Genome-wide association of serum bilirubin levels in Korean population.
20635135 2011 Polymorphisms of the nuclear receptor pregnane X receptor and organic anion transporter polypeptides 1A2, 1B1, 1B3, and 2B1 are not associated with breast cancer risk.
20615467 2010 Uptake transporter organic anion transporting polypeptide 1B3 contributes to the growth of estrogen-dependent breast cancer.
20560925 2011 Frequencies of single-nucleotide polymorphisms of SLCO1A2, SLCO1B3 and SLCO2B1 genes in a Finnish population.
20212519 2011 Polymorphisms in cytochromes P450 2C8 and 3A5 are associated with paclitaxel neurotoxicity.
20130966 2010 DNA methylation profiles of organic anion transporting polypeptide 1B3 in cancer cell lines.
20051929 2010 HIV protease inhibitors are substrates for OATP1A2, OATP1B1 and OATP1B3 and lopinavir plasma concentrations are influenced by SLCO1B1 polymorphisms.
19890249 2010 The role of organic anion-transporting polypeptides and their common genetic variants in mycophenolic acid pharmacokinetics.
19620935 2009 Impact of regulatory polymorphisms in organic anion transporter genes in the human liver.
19442037 2009 Genetic polymorphisms of uptake (OATP1B1, 1B3) and efflux (MRP2, BCRP) transporters: implications for inter-individual differences in the pharmacokinetics and pharmacodynamics of statins and other clinically relevant drugs.
19419973 2009 Common variants in the SLCO1B3 locus are associated with bilirubin levels and unconjugated hyperbilirubinemia.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19228751 2009 Population pharmacokinetics of romidepsin in patients with cutaneous T-cell lymphoma and relapsed peripheral T-cell lymphoma.
19122334 2008 Influence of SLCO1B3 gene polymorphism on the pharmacokinetics of digoxin in terminal renal failure.
19074900 2008 Overexpression of OATP1B3 confers apoptotic resistance in colon cancer.
18695635 2008 Influence of drug transporters and UGT polymorphisms on pharmacokinetics of phenolic glucuronide metabolite of mycophenolic acid in Japanese renal transplant recipients.
18690707 2008 Amino acid residues in transmembrane domain 10 of organic anion transporting polypeptide 1B3 are critical for cholecystokinin octapeptide transport.
18537956 2008 A polymorphism in a transporter of testosterone is a determinant of androgen independence in prostate cancer.
18519758 2008 Effect of SLCO1B3 haplotype on testosterone transport and clinical outcome in caucasian patients with androgen-independent prostatic cancer.
18509328 2008 Influence of solute carriers on the pharmacokinetics of CYP3A4 probes.
18509327 2009 Pharmacogenetic pathway analysis of docetaxel elimination.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18321482 2008 Effect of pregnane X receptor ligands on transport mediated by human OATP1B1 and OATP1B3.
18314419 2008 Interaction of oral antidiabetic drugs with hepatic uptake transporters: focus on organic anion transporting polypeptides and organic cation transporter 1.
18294295 2008 Association of genetic polymorphisms in SLCO1B3 and ABCC2 with docetaxel-induced leukopenia.
18180273 2008 Establishment of a set of double transfectants coexpressing organic anion transporting polypeptide 1B3 and hepatic efflux transporters for the characterization of the hepatobiliary transport of telmisartan acylglucuronide.
18082941 2008 Rapid screening of antineoplastic candidates for the human organic anion transporter OATP1B3 substrates using fluorescent probes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17906856 2007 Influence of SLCO1B1, 1B3, 2B1 and ABCC2 genetic polymorphisms on mycophenolic acid pharmacokinetics in Japanese renal transplant recipients.
17760952 2007 Human liver-specific organic anion transporter-2 is a potent prognostic factor for human breast carcinoma.
17496208 2007 Bosentan is a substrate of human OATP1B1 and OATP1B3: inhibition of hepatic uptake as the common mechanism of its interactions with cyclosporin A, rifampicin, and sildenafil.
17412826 2007 Human organic anion transporter 1B1 and 1B3 function as bidirectional carriers and do not mediate GSH-bile acid cotransport.
17186002 2007 Variants in the SLCO1B3 gene: interethnic distribution and association with paclitaxel pharmacokinetics.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16877380 2006 OATP8/1B3-mediated cotransport of bile acids and glutathione: an export pathway for organic anions from hepatocytes?
16741617 2006 Farnesoid X receptor, hepatocyte nuclear factors 1alpha and 3beta are essential for transcriptional activation of the liver-specific organic anion transporter-2 gene.
16541075 2006 The finished DNA sequence of human chromosome 12.
16534140 2006 Transport of fluorescent chenodeoxycholic acid via the human organic anion transporters OATP1B1 and OATP1B3.
15226676 2004 Mutations in the SLCO1B3 gene affecting the substrate specificity of the hepatocellular uptake transporter OATP1B3 (OATP8).
15159445 2004 Contribution of OATP2 (OATP1B1) and OATP8 (OATP1B3) to the hepatic uptake of pitavastatin in humans.
14993604 2004 Isolation and characterization of a digoxin transporter and its rat homologue expressed in the kidney.
14739090 2004 The human organic anion transporting polypeptide 8 (SLCO1B3) gene is transcriptionally repressed by hepatocyte nuclear factor 3beta in hepatocellular carcinoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14579113 2004 Organic anion transporting polypeptides of the OATP/ SLC21 family: phylogenetic classification as OATP/ SLCO superfamily, new nomenclature and molecular/functional properties.
12695556 2003 Detection of the human organic anion transporters SLC21A6 (OATP2) and SLC21A8 (OATP8) in liver and hepatocellular carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11677211 2001 Hepatic uptake of cholecystokinin octapeptide by organic anion-transporting polypeptides OATP4 and OATP8 of rat and human liver.
11375950 2001 LST-2, a human liver-specific organic anion transporter, determines methotrexate sensitivity in gastrointestinal cancers.
11159893 2001 Organic anion-transporting polypeptide B (OATP-B) and its functional comparison with three other OATPs of human liver.
10779507 2000 Localization and genomic organization of a new hepatocellular organic anion transporting polypeptide.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.