Property Summary

NCBI Gene PubMed Count 11
PubMed Score 18.85
PubTator Score 12.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (9)

Disease log2 FC p
active ulcerative colitis 1.227 2.7e-02
adult high grade glioma -1.100 3.8e-05
glioblastoma -1.200 5.7e-05
group 3 medulloblastoma -1.600 2.3e-05
lung carcinoma 2.200 8.7e-29
osteosarcoma 2.228 4.9e-02
pancreatic cancer 1.400 3.0e-05
posterior fossa group A ependymoma -1.100 1.7e-07
uncontrolled asthma 2.200 3.1e-03

Gene RIF (7)

AA Sequence

MGDEDKRITYEDSEPSTGMNYTPSMHQEAQEETVMKLKGIDANEPTEGSILLKSSEKKLQETPTEANHVQ      1 - 70
RLRQMLACPPHGLLDRVITNVTIIVLLWAVVWSITGSECLPGGNLFGIIILFYCAIIGGKLLGLIKLPTL     71 - 140
PPLPSLLGMLLAGFLIRNIPVINDNVQIKHKWSSSLRSIALSIILVRAGLGLDSKALKKLKGVCVRLSMG    141 - 210
PCIVEACTSALLAHYLLGLPWQWGFILGFVLGAVSPAVVVPSMLLLQGGGYGVEKGVPTLLMAAGSFDDI    211 - 280
LAITGFNTCLGIAFSTGSTVFNVLRGVLEVVIGVATGSVLGFFIQYFPSRDQDKLVCKRTFLVLGLSVLA    281 - 350
VFSSVHFGFPGSGGLCTLVMAFLAGMGWTSEKAEVEKIIAVAWDIFQPLLFGLIGAEVSIASLRPETVGL    351 - 420
CVATVGIAVLIRILTTFLMVCFAGFNLKEKIFISFAWLPKATVQAAIGSVALDTARSHGEKQLEDYGMDV    421 - 490
LTVAFLSILITAPIGSLLIGLLGPRLLQKVEHQNKDEEVQGETSVQV                           491 - 537
//

Text Mined References (16)

PMID Year Title