Property Summary

NCBI Gene PubMed Count 8
PubMed Score 22.48
PubTator Score 8.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Acidosis 3 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.6e-41
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Melanoma 711 0.0 0.5
Skin cancer 469 0.0 0.5
Disease Target Count Z-score Confidence
Celiac disease 116 0.0 3.0
Disease Target Count Z-score Confidence
Metabolic acidosis 90 4.336 2.2
Koolen de Vries syndrome 18 3.819 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 1.6e-41

Gene RIF (3)

AA Sequence

MALQMFVTYSPWNCLLLLVALECSEASSDLNESANSTAQYASNAWFAAASSEPEEGISVFELDYDYVQIP      1 - 70
YEVTLWILLASLAKIGFHLYHRLPGLMPESCLLILVGALVGGIIFGTDHKSPPVMDSSIYFLYLLPPIVL     71 - 140
EGGYFMPTRPFFENIGSILWWAVLGALINALGIGLSLYLICQVKAFGLGDVNLLQNLLFGSLISAVDPVA    141 - 210
VLAVFEEARVNEQLYMMIFGEALLNDGITVVLYNMLIAFTKMHKFEDIETVDILAGCARFIVVGLGGVLF    211 - 280
GIVFGFISAFITRFTQNISAIEPLIVFMFSYLSYLAAETLYLSGILAITACAVTMKKYVEENVSQTSYTT    281 - 350
IKYFMKMLSSVSETLIFIFMGVSTVGKNHEWNWAFICFTLAFCQIWRAISVFALFYISNQFRTFPFSIKD    351 - 420
QCIIFYSGVRGAGSFSLAFLLPLSLFPRKKMFVTATLVVIYFTVFIQGITVGPLVRYLDVKKTNKKESIN    421 - 490
EELHIRLMDHLKAGIEDVCGHWSHYQVRDKFKKFDHRYLRKILIRKNLPKSSIVSLYKKLEMKQAIEMVE    491 - 560
TGILSSTAFSIPHQAQRIQGIKRLSPEDVESIRDILTSNMYQVRQRTLSYNKYNLKPQTSEKQAKEILIR    561 - 630
RQNTLRESMRKGHSLPWGKPAGTKNIRYLSYPYGNPQSAGRDTRAAGFSDDDSSDPGSPSITFSACSRIG    631 - 700
SLQKQEAQEIIPMKSLHRGRKAFSFGYQRNTSQEEYLGGVRRVALRPKPLFHAVDEEGESGGESEGKASL    701 - 770
VEVRSRWTADHGHGRDHHRSHSPLLQKK                                              771 - 798
//

Text Mined References (10)

PMID Year Title