Property Summary

NCBI Gene PubMed Count 1,984
PubMed Score 4217.45
PubTator Score 4693.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
non-small cell lung carcinoma 413 2.13596538598855E-39
lung adenocarcinoma 2714 5.9867410943517E-20
lung carcinoma 2844 1.54712023727129E-13
osteosarcoma 7933 1.20783043373085E-4
active Crohn's disease 918 0.00496859238347195
lung cancer 4473 0.00936905170898759
non primary Sjogren syndrome sicca 840 0.0235824188152906
Breast cancer 3099 0.0322873062772331

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.113 0.000
non-small cell lung carcinoma -4.400 0.000
lung cancer -1.200 0.009
active Crohn's disease -1.207 0.005
lung adenocarcinoma -4.300 0.000
non primary Sjogren syndrome sicca -1.500 0.024
lung carcinoma -4.500 0.000
Breast cancer 1.100 0.032

Synonym

Accession P31645 Q5EE02 SERT
Symbols HTT
5HTT
OCD1
SERT
5-HTT
SERT1
hSERT
5-HTTLPR

Gene

PANTHER Protein Class (2)

PDB

5I6X   5I6Z   5I71   5I73   5I74   5I75  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

MLP Assay (14)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
686924 other 0 / 0 / 1 ML347 Eurofin Panel Assay for BMP Inhibitor (Probe Compound)
686925 other 0 / 0 / 1 ML352 Eurofin Panel Assay for Choline Transporter Inhibitor (Probe Compound)
686926 other 0 / 0 / 1 ML354 Eurofin Panel Assay for PAR4 Antagonists Inhibitor (Probe Compound)
686927 other 0 / 0 / 1 ML353 Eurofin Panel Assay for mGlu5 SAM Inhibitor (Probe Compound)
743249 screening 1 / 0 / 0 Development of the First Potent, Selective and CNS penetrant M5 Negative Allosteric Modulator (NAM)
743250 screening 1 / 0 / 0 Discovery and characterization of a small molecule allosteric agonists of mas-related G-Protein coupled receptor X1 ( MrgX1)
More...

Gene RIF (2458)

PMID Text
27192815 population genetics analysis showed the highest frequency of the SS genotype 5-HTTLPR in wrestlers than in control group.
27089947 Data indicate the high-affinity antidepressant binding site in serotonin transporter (hSERT).
27049939 X-ray crystallographic structures of human SERT at 3.15 A resolution bound to the antidepressants (S)-citalopram or paroxetine
27043930 the polymorphism 5-HTTLPR may affect the development and maintenance of pain via two independent routes, the sensory processes of subjective pain experiences and the booster effects of pain catastrophizing.
26995959 Heterozygote carriers of less active ("short") variant of the serotonin transporter gene 5-HTTL had more physical aggression, guilt and were less frustrated compared with carriers of two long alleles.
26980363 Symptoms of lack of positive affect decreased more in men compared to women possessing the 5-HTT L allele, but the effect did not differ by Physical Activity intervention.
26976307 Expression of brain-derived neurotrophic factor (BDNF) and the serotonin transporter (5-HTT)have been linked with major depressive disorder.
26938215 The carriers of one or more of the 5-HTTLPR S-alleles were more sensitive to stress than those with two L-alleles and at a higher risk for depression.
26921052 Our findings suggest that adolescents with a genotype conferring a low 5-HTT activity are more vulnerable to a childhood adversity-associated executive dysfunction in their daily life.
26909988 The study describes a positive association between 5-HTTLPR and post-stroke depression in a Han Chinese population.
More...

AA Sequence

METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTL      1 - 70
VAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALG     71 - 140
QYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCT    141 - 210
NYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKV    211 - 280
VWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASY    281 - 350
NKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS    351 - 420
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVK    421 - 490
LLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSP    491 - 560
PQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV    561 - 630
//

Text Mined References (1986)

PMID Year Title
27192815 2015 [ASSOCIATION BETWEEN FOUR SEROTONIC GENES POLYMORPHISM (5HTTL, 5HT1A, 5HT2A, AND MAOA) AND PERSONALITY TRAITS IN WRESTLERS AND CONTROL GROUP].
27089947 2016 Genetically encoded photocrosslinkers locate the high-affinity binding site of antidepressant drugs in the human serotonin transporter.
27049939 2016 X-ray structures and mechanism of the human serotonin transporter.
27043930 2016 Relationship of 5-HTTLPR Polymorphism with Various Factors of Pain Processing: Subjective Experience, Motor Responsiveness and Catastrophizing.
26995959 2015 [THE INFLUENCE OF SEROTONIN TRANSPORTER AND MONOAMINE OXIDASE A GENES POLYMORPHISM ON PSYCHO-EMOTION AND KARYOLOGICAL STABILITY OF ATHLETES].
26980363 2016 Genetic Moderators of the Impact of Physical Activity on Depressive Symptoms.
26976307 2016 The influence of 5-HTTLPR and Val66Met polymorphisms on cortical thickness and volume in limbic and paralimbic regions in depression: a preliminary study.
26938215 2016 Depression, Stressful Life Events, and the Impact of Variation in the Serotonin Transporter: Findings from the National Longitudinal Study of Adolescent to Adult Health (Add Health).
26921052 2016 5-HTTLPR, victimization and ecological executive function of adolescents.
26909988 2016 Relationship between 5-HTTLPR polymorphism and post-stroke depression.
More...