Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.99
PubTator Score 2.31

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.700 5.7e-05
intraductal papillary-mucinous neoplasm ... -1.200 1.9e-02
lung carcinoma -1.200 3.5e-11
malignant mesothelioma 2.200 2.1e-07
medulloblastoma 1.100 1.7e-03
osteosarcoma -3.302 1.2e-07
posterior fossa group B ependymoma 1.100 5.6e-06
psoriasis -1.300 5.5e-03

AA Sequence

MKTEAQPSTSLLANTSWTGTVISDSVPGSQTWEDKGSLTRSATSWTSEAQVSAARVAEAQARTSQPKQIS      1 - 70
VLEALTASALNQKPTHEKVQMTEKKESEVLLARPFWSSKTEYILAQVGFSMKPSCLWRFAYLWLNSGGCS     71 - 140
FAAIYIFMLFLVGVPLLFLEMAAGQSMRQGGMGVWKIIAPWIGGVGYSSFMVCFILGLYFNVVNSWIIFY    141 - 210
MSQSFQFPVPWEKCPLTMNSSGFDPECERTTPSIYFWYQQALKASDRIEDGGSPVYSLVLPFFLCWCLVG    211 - 280
AFMINGLKSTGKVIYVLVLLPCFIIVGFFIRTLLLEGAKFGLQQLVVAKISDVYNMSVWSLAGGQVLSNT    281 - 350
GIGLGSVASLASYMPQSNNCLSDAFLVSVINLLTLLVFTSFNFCVLGFWATVITHRCCERNAEILLKLIN    351 - 420
LGKLPPDAKPPVNLLYNPTSIYNAWLSGLPQHIKSMVLREVTECNIETQFLKASEGPKFAFLSFVEAMSF    421 - 490
LPPSVFWSFIFFLMLLAMGLSSAIGIMQGIITPLQDTFSFFRKHTKLLIVGVFLLMFVCGLFFTRPSGSY    491 - 560
FIRLLSDYWIVFPIIVVVVFETMAVSWAYGARRFLADLTILLGHPISPIFGWLWPHLCPVVLLIIFVTMM    561 - 630
VHLCMKPITYMSWDSSTSKEVLRPYPPWALLLMITLFAIVILPIPAYFVYCRIHRIPFRPKSGDGPMTAS    631 - 700
TSLPLSHQLTPSKEVQKEEILQVDETKYPSTCNVTS                                      701 - 736
//

Text Mined References (7)

PMID Year Title