Property Summary

NCBI Gene PubMed Count 15
PubMed Score 52.55
PubTator Score 16.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -7.000 3.3e-10
astrocytic glioma -2.600 1.5e-03
ependymoma -3.000 4.9e-20
oligodendroglioma -2.600 1.3e-03
glioblastoma -3.200 6.5e-07
sonic hedgehog group medulloblastoma 2.200 2.7e-03
cystic fibrosis 2.728 5.9e-07
atypical teratoid / rhabdoid tumor -3.100 1.1e-05
medulloblastoma, large-cell 1.900 2.0e-02
primitive neuroectodermal tumor -2.700 3.7e-03
non-small cell lung cancer 1.359 1.8e-05
lung cancer 1.400 7.2e-04
adult high grade glioma -3.000 9.3e-08
pilocytic astrocytoma -3.800 2.8e-13
subependymal giant cell astrocytoma -2.739 3.6e-03
Pick disease -1.900 8.5e-04
pituitary cancer -4.200 3.6e-15
psoriasis 1.300 1.1e-50

 MGI Phenotype (1)

Gene RIF (5)

PMID Text
23820837 SNP rs1545843 associated with with local gray matter volume in median cingulate gyrus
22475622 The SLC6A15 gene plays a role in adrenocorticotropic hormone (ACTH) and cortisol secretion during cognitive impairments in unipolar depression.
21521612 The data from human genetics(SLC6A15), expression studies, brain imaging, and animal models suggest a pathophysiological mechanism for MD that may be accessible to drug targeting.
19147495 The substrate profile of the NTT4/XT1-dependent activity is similar to that of the closely related B(0)AT2/SBAT1 (SLC6A15), including a submillimolar apparent affinity for proline and leucine and a low millimolar apparent affinity for glutamine.
16226721 SBAT1-mediated transport of BCAA, particularly leucine, may be an important source of amino nitrogen for neurotransmitter synthesis in glutamatergic and GABAergic neurons.

AA Sequence

MPKNSKVVKRELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDERPAWNSKLQY      1 - 70
ILAQVGFSVGLGNVWRFPYLCQKNGGGAYLLPYLILLMVIGIPLFFLELSVGQRIRRGSIGVWNYISPKL     71 - 140
GGIGFASCVVCYFVALYYNVIIGWSLFYFSQSFQQPLPWDQCPLVKNASHTFVEPECEQSSATTYYWYRE    141 - 210
ALNISSSISESGGLNWKMTICLLAAWVMVCLAMIKGIQSSGKIIYFSSLFPYVVLICFLIRAFLLNGSID    211 - 280
GIRHMFTPKLEIMLEPKVWREAATQVFFALGLGFGGVIAFSSYNKRDNNCHFDAVLVSFINFFTSVLATL    281 - 350
VVFAVLGFKANVINEKCITQNSETIMKFLKMGNISQDIIPHHINLSTVTAEDYHLVYDIIQKVKEEEFPA    351 - 420
LHLNSCKIEEELNKAVQGTGLAFIAFTEAMTHFPASPFWSVMFFLMLVNLGLGSMFGTIEGIVTPIVDTF    421 - 490
KVRKEILTVICCLLAFCIGLIFVQRSGNYFVTMFDDYSATLPLLIVVILENIAVCFVYGIDKFMEDLKDM    491 - 560
LGFAPSRYYYYMWKYISPLMLLSLLIASVVNMGLSPPGYNAWIEDKASEEFLSYPTWGLVVCVSLVVFAI    561 - 630
LPVPVVFIVRRFNLIDDSSGNLASVTYKRGRVLKEPVNLEGDDTSLIHGKIPSEMPSPNFGKNIYRKQSG    631 - 700
SPTLDTAPNGRYGIGYLMADIMPDMPESDL                                            701 - 730
//

Text Mined References (22)

PMID Year Title
23942779 2013 A genome-wide association study of behavioral disinhibition.
23820837 2013 SLC6A15 rs1545843 and depression: implications from brain imaging data.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22475622 2013 A variant of the neuronal amino acid transporter SLC6A15 is associated with ACTH and cortisol responses and cognitive performance in unipolar depression.
21521612 2011 The neuronal transporter gene SLC6A15 confers risk to major depression.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19147495 2009 Synaptic Vesicle Protein NTT4/XT1 (SLC6A17) Catalyzes Na+-coupled Neutral Amino Acid Transport.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16226721 2005 Characterization of a branched-chain amino-acid transporter SBAT1 (SLC6A15) that is expressed in human brain.
16185194 2006 The orphan transporter v7-3 (slc6a15) is a Na+-dependent neutral amino acid transporter (B0AT2).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11112352 2000 Cloning and characterization of human NTT5 and v7-3: two orphan transporters of the Na+/Cl- -dependent neurotransmitter transporter gene family.
10471414 1999 Neurotransmitter transporters in the central nervous system.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.