Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.01
PubTator Score 5.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
cystic fibrosis -1.257 1.0e-04
medulloblastoma, large-cell -1.500 3.1e-02
intraductal papillary-mucinous adenoma (... 1.200 8.4e-04
intraductal papillary-mucinous carcinoma... 1.100 1.2e-02
interstitial cystitis -3.600 7.9e-06
group 3 medulloblastoma -2.000 1.8e-03
pilocytic astrocytoma 1.400 2.5e-04
posterior fossa group A ependymoma 1.200 7.9e-04
aldosterone-producing adenoma -1.884 6.9e-03
lung carcinoma -1.600 3.0e-16
ductal carcinoma in situ 1.200 2.6e-02
ovarian cancer -1.600 3.9e-05
pituitary cancer -2.300 8.2e-06

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MHCLGAEYLVSAEGAPRQREWRPQIYRKCTDTAWLFLFFLFWTGLVFIMGYSVVAGAAGRLLFGYDSFGN      1 - 70
MCGKKNSPVEGAPLSGQDMTLKKHVFFMNSCNLEVKGTQLNRMALCVSNCPEEQLDSLEEVQFFANTSGS     71 - 140
FLCVYSLNSFNYTHSPKADSLCPRLPVPPSKSFPLFNRCVPQTPECYSLFASVLINDVDTLHRILSGIMS    141 - 210
GRDTILGLCILALALSLAMMFTFRFITTLLVHIFISLVILGLLFVCGVLWWLYYDYTNDLSIELDTEREN    211 - 280
MKCVLGFAIVSTGITAVLLVLIFVLRKRIKLTVELFQITNKAISSAPFLLFQPLWTFAILIFFWVLWVAV    281 - 350
LLSLGTAGAAQVMEGGQVEYKPLSGIRYMWSYHLIGLIWTSEFILACQQMTIAGAVVTCYFNRSKNDPPD    351 - 420
HPILSSLSILFFYHQGTVVKGSFLISVVRIPRIIVMYMQNALKEQQHGALSRYLFRCCYCCFWCLDKYLL    421 - 490
HLNQNAYTTTAINGTDFCTSAKDAFKILSKNSSHFTSINCFGDFIIFLGKVLVVCFTVFGGLMAFNYNRA    491 - 560
FQVWAVPLLLVAFFAYLVAHSFLSVFETVLDALFLCFAVDLETNDGSSEKPYFMDQEFLSFVKRSNKLNN    561 - 630
ARAQQDKHSLRNEEGTELQAIVR                                                   631 - 653
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
22238593 2012 A genome-wide association search for type 2 diabetes genes in African Americans.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15715662 2005 Molecular characterization of the family of choline transporter-like proteins and their splice variants.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10677542 2000 An electric lobe suppressor for a yeast choline transport mutation belongs to a new family of transporter-like proteins.