Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.42
PubTator Score 5.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
aldosterone-producing adenoma -1.884 6.9e-03
Astrocytoma, Pilocytic 1.400 2.9e-04
cystic fibrosis -1.257 1.0e-04
ductal carcinoma in situ 1.200 2.6e-02
group 3 medulloblastoma -2.000 1.8e-03
interstitial cystitis -2.800 2.4e-03
intraductal papillary-mucinous adenoma (... 1.200 8.4e-04
intraductal papillary-mucinous carcinoma... 1.100 1.2e-02
lung carcinoma -1.600 3.0e-16
medulloblastoma, large-cell -1.500 3.1e-02
ovarian cancer -1.600 3.9e-05
pituitary cancer -2.300 8.2e-06
posterior fossa group A ependymoma 1.200 7.9e-04

Gene RIF (1)

AA Sequence

MHCLGAEYLVSAEGAPRQREWRPQIYRKCTDTAWLFLFFLFWTGLVFIMGYSVVAGAAGRLLFGYDSFGN      1 - 70
MCGKKNSPVEGAPLSGQDMTLKKHVFFMNSCNLEVKGTQLNRMALCVSNCPEEQLDSLEEVQFFANTSGS     71 - 140
FLCVYSLNSFNYTHSPKADSLCPRLPVPPSKSFPLFNRCVPQTPECYSLFASVLINDVDTLHRILSGIMS    141 - 210
GRDTILGLCILALALSLAMMFTFRFITTLLVHIFISLVILGLLFVCGVLWWLYYDYTNDLSIELDTEREN    211 - 280
MKCVLGFAIVSTGITAVLLVLIFVLRKRIKLTVELFQITNKAISSAPFLLFQPLWTFAILIFFWVLWVAV    281 - 350
LLSLGTAGAAQVMEGGQVEYKPLSGIRYMWSYHLIGLIWTSEFILACQQMTIAGAVVTCYFNRSKNDPPD    351 - 420
HPILSSLSILFFYHQGTVVKGSFLISVVRIPRIIVMYMQNALKEQQHGALSRYLFRCCYCCFWCLDKYLL    421 - 490
HLNQNAYTTTAINGTDFCTSAKDAFKILSKNSSHFTSINCFGDFIIFLGKVLVVCFTVFGGLMAFNYNRA    491 - 560
FQVWAVPLLLVAFFAYLVAHSFLSVFETVLDALFLCFAVDLETNDGSSEKPYFMDQEFLSFVKRSNKLNN    561 - 630
ARAQQDKHSLRNEEGTELQAIVR                                                   631 - 653
//

Text Mined References (13)

PMID Year Title