Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.56
PubTator Score 2.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Protein-protein Interaction (4)

Gene RIF (6)

PMID Text
25921144 In glioma tumors, low ZIP11 expression was significantly associated with higher grade. Higher ZIP11 expression was weakly correlated with IDH1 mutation status.
25900876 Polymorphisms within ZIP11 gene were significantly associated with bladder cancer risk.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
11707075 This paper describes the genomic region surrounding the SOX9 gene which includes SLC39A11 (C17orf26).

AA Sequence

MLQGHSSVFQALLGTFFTWGMTAAGAALVFVFSSGQRRILDGSLGFAAGVMLAASYWSLLAPAVEMATSS      1 - 70
GGFGAFAFFPVAVGFTLGAAFVYLADLLMPHLGAAEDPQTTLALNFGSTLMKKKSDPEGPALLFPESELS     71 - 140
IRIGRAGLLSDKSENGEAYQRKKAAATGLPEGPAVPVPSRGNLAQPGGSSWRRIALLILAITIHNVPEGL    141 - 210
AVGVGFGAIEKTASATFESARNLAIGIGIQNFPEGLAVSLPLRGAGFSTWRAFWYGQLSGMVEPLAGVFG    211 - 280
AFAVVLAEPILPYALAFAAGAMVYVVMDDIIPEAQISGNGKLASWASILGFVVMMSLDVGLG            281 - 342
//

Text Mined References (22)

PMID Year Title
25921144 2015 Expression Profile Analysis of Zinc Transporters (ZIP4, ZIP9, ZIP11, ZnT9) in Gliomas and their Correlation with IDH1 Mutation Status.
25900876 2015 Zinc transporter genes and urological cancers: integrated analysis suggests a role for ZIP11 in bladder cancer.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
24124411 2013 Genome-wide association study of liver enzymes in korean children.
24068947 2013 Common variants in left/right asymmetry genes and pathways are associated with relative hand skill.
23698163 2013 Genome-wide association study of serum selenium concentrations.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19451621 2009 Reduced expression of the Kinesin-Associated Protein 3 (KIFAP3) gene increases survival in sporadic amyotrophic lateral sclerosis.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707075 2001 Comparative genomics of the SOX9 region in human and Fugu rubripes: conservation of short regulatory sequence elements within large intergenic regions.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.