Property Summary

NCBI Gene PubMed Count 36
PubMed Score 96.50
PubTator Score 66.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Down syndrome 1.200 3.7e-03
hereditary spastic paraplegia -1.536 6.4e-03
Multiple myeloma 1.549 1.2e-02
osteosarcoma 1.143 3.6e-03
ovarian cancer -1.400 1.0e-02
pancreatic ductal adenocarcinoma liver m... -1.136 2.6e-02
pituitary cancer -1.100 6.4e-04
subependymal giant cell astrocytoma -1.823 4.8e-02
Waldenstrons macroglobulinemia 1.357 2.8e-02

Gene RIF (26)

AA Sequence

MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKKKYETEFHPGT      1 - 70
TSFGMSVFNLSNAIVGSGILGLSYAMANTGIALFIILLTFVSIFSLYSVHLLLKTANEGGSLLYEQLGYK     71 - 140
AFGLVGKLAASGSITMQNIGAMSSYLFIVKYELPLVIQALTNIEDKTGLWYLNGNYLVLLVSLVVILPLS    141 - 210
LFRNLGYLGYTSGLSLLCMVFFLIVVICKKFQVPCPVEAALIINETINTTLTQPTALVPALSHNVTENDS    211 - 280
CRPHYFIFNSQTVYAVPILIFSFVCHPAVLPIYEELKDRSRRRMMNVSKISFFAMFLMYLLAALFGYLTF    281 - 350
YEHVESELLHTYSSILGTDILLLIVRLAVLMAVTLTVPVVIFPIRSSVTHLLCASKDFSWWRHSLITVSI    351 - 420
LAFTNLLVIFVPTIRDIFGFIGASAASMLIFILPSAFYIKLVKKEPMKSVQKIGALFFLLSGVLVMTGSM    421 - 490
ALIVLDWVHNAPGGGH                                                          491 - 506
//

Text Mined References (45)

PMID Year Title