Property Summary

NCBI Gene PubMed Count 26
PubMed Score 44.22
PubTator Score 34.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Multiple myeloma 1.285 5.4e-03
oligodendroglioma 1.400 2.2e-02
osteosarcoma 1.545 4.2e-04
ependymoma -2.000 3.7e-06
atypical teratoid/rhabdoid tumor -2.700 4.1e-05
glioblastoma -1.300 2.0e-02
juvenile dermatomyositis 2.092 3.0e-09
Duchenne muscular dystrophy 1.217 4.5e-03
autosomal dominant Emery-Dreifuss muscul... 1.331 4.8e-02
acute quadriplegic myopathy 1.319 2.2e-02
non-small cell lung cancer 1.116 7.9e-12
intraductal papillary-mucinous carcinoma... 1.300 3.6e-02
X-linked cerebral adrenoleukodystrophy 1.300 4.2e-02
lung cancer 3.200 1.0e-04
breast carcinoma 1.500 2.3e-03
fibroadenoma 1.900 3.9e-02
pediatric high grade glioma -1.400 1.9e-03
primary Sjogren syndrome 1.100 3.1e-02
subependymal giant cell astrocytoma -1.080 1.5e-02
invasive ductal carcinoma 2.400 1.0e-02
lung carcinoma 2.000 7.9e-31
gastric carcinoma 1.100 1.2e-02
ductal carcinoma in situ 2.100 4.1e-03
ovarian cancer 3.100 1.5e-06

Gene RIF (14)

PMID Text
27129276 In the absence of SLC1A5 there is a crucial role of SNAT1 in supplying glutamine for glutaminolysis with SNAT2 acting as a "backup" for glutamine transport.
26439863 HIV-1 Vpu degrades SLC38A1 (SNAT1) via the same pathway utilized for antgonism of BST2 (tetherin) but occurs independently of BST2 (tetherin) downregulation
24712400 The SLC38A1 protein was very low or undetectable in healthy gastric mucosa but strong staining of SLC38A1 protein was found in the cytoplasm in more than half of gastric cancer samples. SLC38A1 knockdown decreased tumor cell proliferation and migration.
23848995 The cross-talk between Akt signaling and SNAT1 might play a critical role in the development and progression of breast cancer
23408887 SLC38A1 and SLC38A2 transcript levels are altered in placental malaria with intervillositis.
21219957 results suggest that slc38a1 may play a role in the mechanisms underlying the determination of cellular viability in astrocytes through modulation of intracellular ROS generation
20605601 Increased expression of ATA1 is frequent in human hilar cholangiocarcinoma and significantly correlated with the progression of cholangiocarcinoma, suggesting the importance of ATA1 in cancer development and progression.
20599747 SNAT1 is a key contributor to system A activity at term.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20308991 The results of this study provided that RAB2A and SLC38A1, were associated with the density of calbindin-positive neurons and the number of perineuronal oligodendrocytes in psychiatric disorders.
20308991 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19442705 A possible association between low expression of SNAT1 and suicidal behavior is suggested.
18703994 Report SNAT1 activity in fetal T lymphocytes in intrauterine growth restriction and with tumor necrosis factor-alpha treatment.
17549407 Theses data demonstrate the physiological importance of ATA1 in hepatocarcinogenesis.

AA Sequence

MMHFKSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKKKCDEYIPGT      1 - 70
TSLGMSVFNLSNAIMGSGILGLAFALANTGILLFLVLLTSVTLLSIYSINLLLICSKETGCMVYEKLGEQ     71 - 140
VFGTTGKFVIFGATSLQNTGAMLSYLFIVKNELPSAIKFLMGKEETFSAWYVDGRVLVVIVTFGIILPLC    141 - 210
LLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTNADTCTPKYVTFNSKTVYALP    211 - 280
TIAFAFVCHPSVLPIYSELKDRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDD    281 - 350
ILILTVRLAVIVAVILTVPVLFFTVRSSLFELAKKTKFNLCRHTVVTCILLVVINLLVIFIPSMKDIFGV    351 - 420
VGVTSANMLIFILPSSLYLKITDQDGDKGTQRIWAALFLGLGVLFSLVSIPLVIYDWACSSSSDEGH       421 - 487
//

Text Mined References (36)

PMID Year Title
27129276 2016 Deletion of Amino Acid Transporter ASCT2 (SLC1A5) Reveals an Essential Role for Transporters SNAT1 (SLC38A1) and SNAT2 (SLC38A2) to Sustain Glutaminolysis in Cancer Cells.
25416956 2014 A proteome-scale map of the human interactome network.
24712400 2014 Overexpression of SLC38A1 is associated with poorer prognosis in Chinese patients with gastric cancer.
23848995 2013 Activation of SNAT1/SLC38A1 in human breast cancer: correlation with p-Akt overexpression.
23506890 Evolutionary origin of amino acid transporter families SLC32, SLC36 and SLC38 and physiological, pathological and therapeutic aspects.
23408887 2013 Plasmodium falciparum malaria elicits inflammatory responses that dysregulate placental amino acid transport.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21219957 2011 Exacerbated vulnerability to oxidative stress in astrocytic C6 glioma cells with stable overexpression of the glutamine transporter slc38a1.
20605601 2011 Overexpression of ATA1/SLC38A1 predicts future recurrence and death in Chinese patients with hilar cholangiocarcinoma.
20599747 2010 The contribution of SNAT1 to system A amino acid transporter activity in human placental trophoblast.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20308991 2011 Integrative genome-wide association analysis of cytoarchitectural abnormalities in the prefrontal cortex of psychiatric disorders.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19442705 2009 SNAT1 and a family with high rates of suicidal behavior.
18703994 2009 Amino acid transport systems beta and A in fetal T lymphocytes in intrauterine growth restriction and with tumor necrosis factor-alpha treatment.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
17549407 2007 Activation of a system A amino acid transporter, ATA1/SLC38A1, in human hepatocellular carcinoma and preneoplastic liver tissues.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16583402 2006 Functional expression of A glutamine transporter responsive to down-regulation by lipopolysaccharide through reduced promoter activity in cultured rat neocortical astrocytes.
16516348 High-affinity glutamate transporter GLAST/EAAT1 regulates cell surface expression of glutamine/neutral amino acid transporter ASCT2 in human fetal astrocytes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16148032 2006 SNAT4 isoform of system A amino acid transporter is expressed in human placenta.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15054072 2004 Localization of the glutamine transporter SNAT1 in rat cerebral cortex and neighboring structures, with a note on its localization in human cortex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388062 2003 Hypoxia reduces expression and function of system A amino acid transporters in cultured term human trophoblasts.
11325958 2001 Characterization of an N-system amino acid transporter expressed in retina and its involvement in glutamine transport.
10891391 2000 Cloning and functional expression of ATA1, a subtype of amino acid transporter A, from human placenta.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7750094 1995 Identification of novel genes from stomach cancer cell lines by differential display.