Property Summary

NCBI Gene PubMed Count 29
PubMed Score 53.52
PubTator Score 34.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
acute quadriplegic myopathy 1.319 2.2e-02
atypical teratoid / rhabdoid tumor -2.400 2.8e-04
autosomal dominant Emery-Dreifuss muscul... 1.331 4.8e-02
breast carcinoma 1.500 2.3e-03
Duchenne muscular dystrophy 1.217 4.5e-03
ductal carcinoma in situ 1.900 6.0e-03
ependymoma -2.000 3.7e-06
fibroadenoma 1.800 2.8e-02
gastric carcinoma 1.100 1.2e-02
glioblastoma -1.300 2.0e-02
intraductal papillary-mucinous carcinoma... 1.300 3.6e-02
invasive ductal carcinoma 1.013 2.9e-02
juvenile dermatomyositis 1.519 5.7e-08
lung cancer 3.200 1.0e-04
lung carcinoma 2.000 7.9e-31
Multiple myeloma 1.285 5.4e-03
non-small cell lung cancer 1.116 7.9e-12
oligodendroglioma 1.200 2.6e-02
osteosarcoma 1.545 4.2e-04
ovarian cancer 1.200 1.4e-02
pediatric high grade glioma -1.400 1.9e-03
primary Sjogren syndrome 1.100 3.1e-02
subependymal giant cell astrocytoma -1.080 1.5e-02
X-linked cerebral adrenoleukodystrophy 1.300 4.2e-02

Gene RIF (18)

AA Sequence

MMHFKSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKKKCDEYIPGT      1 - 70
TSLGMSVFNLSNAIMGSGILGLAFALANTGILLFLVLLTSVTLLSIYSINLLLICSKETGCMVYEKLGEQ     71 - 140
VFGTTGKFVIFGATSLQNTGAMLSYLFIVKNELPSAIKFLMGKEETFSAWYVDGRVLVVIVTFGIILPLC    141 - 210
LLKNLGYLGYTSGFSLSCMVFFLIVVIYKKFQIPCIVPELNSTISANSTNADTCTPKYVTFNSKTVYALP    211 - 280
TIAFAFVCHPSVLPIYSELKDRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDD    281 - 350
ILILTVRLAVIVAVILTVPVLFFTVRSSLFELAKKTKFNLCRHTVVTCILLVVINLLVIFIPSMKDIFGV    351 - 420
VGVTSANMLIFILPSSLYLKITDQDGDKGTQRIWAALFLGLGVLFSLVSIPLVIYDWACSSSSDEGH       421 - 487
//

Text Mined References (39)

PMID Year Title