Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.61
PubTator Score 2.20

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
21949678 Data show that SLC37A1 and SLC37A2 are endoplasmic reticulum associated, P(i)-linked antiporters, that can transport glucose-6-phosphate.

AA Sequence

MARLPAGIRFIISFSRDQWYRAFIFILTFLLYASFHLSRKPISIVKGELHKYCTAWDEADVRFSSQNRKS      1 - 70
GSAAPHQLPDNETDCGWAPFDKNNYQQLLGALDYSFLCAYAVGMYLSGIIGERLPIRYYLTFGMLASGAF     71 - 140
TALFGLGYFYNIHSFGFYVVTQVINGLVQTTGWPSVVTCLGNWFGKGRRGLIMGVWNSHTSVGNILGSLI    141 - 210
AGYWVSTCWGLSFVVPGAIVAAMGIVCFLFLIEHPNDVRCSSTLVTHSKGYENGTNRLRLQKQILKSEKN    211 - 280
KPLDPEMQCLLLSDGKGSIHPNHVVILPGDGGSGTAAISFTGALKIPGVIEFSLCLLFAKLVSYTFLFWL    281 - 350
PLYITNVDHLDAKKAGELSTLFDVGGIFGGILAGVISDRLEKRASTCGLMLLLAAPTLYIFSTVSKMGLE    351 - 420
ATIAMLLLSGALVSGPYTLITTAVSADLGTHKSLKGNAHALSTVTAIIDGTGSVGAALGPLLAGLLSPSG    421 - 490
WSNVFYMLMFADACALLFLIRLIHKELSCPGSATGDQVPFKEQ                               491 - 533
//

Text Mined References (7)

PMID Year Title
21949678 2011 SLC37A1 and SLC37A2 are phosphate-linked, glucose-6-phosphate antiporters.
19946888 2010 Defining the membrane proteome of NK cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15862967 2005 Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11112347 2000 Cloning and characterization of a putative human glycerol 3-phosphate permease gene (SLC37A1 or G3PP) on 21q22.3: mutation analysis in two candidate phenotypes, DFNB10 and a glycerol kinase deficiency.
10830953 2000 The DNA sequence of human chromosome 21.