Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P0C7Q6
Symbols AMAC1L3
TMEM21B

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Rat OMA Inparanoid

Gene RIF (1)

PMID Text
18950845 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGSHPYLNPPDSTHPSPPSAPPSLRWHQCCQPSDATNGLLVALLGGGLPAGFVGPLSHMAYQASNLPSL      1 - 70
ELLICRCLFHLPIALLLKLRGDPLLGPPDIRGRAYFYALLNVLSIGCAYSAVQVVPAGNAATVRKGSSTV     71 - 140
CSAVLTLCLESQGLSGYDWCGLLGSILGLIIIVGPGLWTLQEGITGVYTALGYGQAFVGGLALSLGLLVY    141 - 210
RSLHFPSCLPTVAFLSGLVGLLGSVPGLFVLQPPVLPSDLPSWSCVGAVGILALVSFTCVSYAVTKAHPA    211 - 280
LVCAVLHSEVVVALILQYYMLHETVAPSDIVGAGVVLGSIAIITAWNLSCEREGKVEE                281 - 338
//

Text Mined References (3)

PMID Year Title
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
17101974 2006 Emergence of primate genes by retrotransposon-mediated sequence transduction.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.