Property Summary

NCBI Gene PubMed Count 10
PubMed Score 75.31
PubTator Score 11.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
colon cancer -1.100 1.1e-02
glioblastoma 1.100 3.7e-05
intraductal papillary-mucinous adenoma (... 1.300 4.8e-04
intraductal papillary-mucinous carcinoma... 1.600 5.4e-04
intraductal papillary-mucinous neoplasm ... 1.500 3.3e-03
osteosarcoma -1.501 9.8e-04
ovarian cancer 1.300 9.2e-04
pancreatic ductal adenocarcinoma liver m... -1.362 7.2e-03
pediatric high grade glioma 1.100 5.2e-07
psoriasis -2.600 8.1e-05
spina bifida -1.468 4.1e-02

Gene RIF (11)

AA Sequence

MFANLKYVSLGILVFQTTSLVLTMRYSRTLKEEGPRYLSSTAVVVAELLKIMACILLVYKDSKCSLRALN      1 - 70
RVLHDEILNKPMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLSKKLGVYQ     71 - 140
WLSLVILMTGVAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQ    141 - 210
LGFFGSIFGLMGVYIYDGELVSKNGFFQGYNRLTWIVVVLQALGGLVIAAVIKYADNILKGFATSLSIIL    211 - 280
STLISYFWLQDFVPTSVFFLGAILVITATFLYGYDPKPAGNPTKA                             281 - 325
//

Text Mined References (14)

PMID Year Title