Property Summary

NCBI Gene PubMed Count 18
PubMed Score 25.65
PubTator Score 16.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 1.113 2.8e-02
acute quadriplegic myopathy 1.172 1.9e-06
adult high grade glioma 1.300 3.0e-03
atypical teratoid / rhabdoid tumor 1.400 1.2e-05
gastric cancer 1.200 1.4e-03
glioblastoma 1.100 1.2e-06
group 4 medulloblastoma 1.100 1.2e-03
hepatocellular carcinoma 1.500 8.5e-05
lung adenocarcinoma 1.198 3.7e-06
medulloblastoma, large-cell 1.300 1.2e-04
Multiple myeloma 1.130 2.0e-02
osteosarcoma -1.477 1.6e-08
ovarian cancer -1.300 3.1e-04
primary Sjogren syndrome 1.100 1.1e-02
psoriasis -2.300 5.2e-05
tuberculosis -1.300 3.5e-05
Waldenstrons macroglobulinemia 1.059 1.5e-02

Gene RIF (11)

AA Sequence

MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFTKFLKAVGLFESYDLLKAVHIVQFIFILKLGT      1 - 70
AFFMVLFQKPFSSGKTITKHQWIKIFKHAVAGCIISLLWFFGLTLCGPLRTLLLFEHSDIVVISLLSVLF     71 - 140
TSSGGGPAKTRGAAFFIIAVICLLLFDNDDLMAKMAEHPEGHHDSALTHMLYTAIAFLGVADHKGGVLLL    141 - 210
VLALCCKVGFHTASRKLSVDVGGAKRLQALSHLVSVLLLCPWVIVLSVTTESKVESWFSLIMPFATVIFF    211 - 280
VMILDFYVDSICSVKMEVSKCARYGSFPIFISALLFGNFWTHPITDQLRAMNKAAHQESTEHVLSGGVVV    281 - 350
SAIFFILSANILSSPSKRGQKGTLIGYSPEGTPLYNFMGDAFQHSSQSIPRFIKESLKQILEESDSRQIF    351 - 420
YFLCLNLLFTFVELFYGVLTNSLGLISDGFHMLFDCSALVMGLFAALMSRWKATRIFSYGYGRIEILSGF    421 - 490
INGLFLIVIAFFVFMESVARLIDPPELDTHMLTPVSVGGLIVNLIGICAFSHAHSHAHGASQGSCHSSDH    491 - 560
SHSHHMHGHSDHGHGHSHGSAGGGMNANMRGVFLHVLADTLGSIGVIVSTVLIEQFGWFIADPLCSLFIA    561 - 630
ILIFLSVVPLIKDACQVLLLRLPPEYEKELHIALEKIQKIEGLISYRDPHFWRHSASIVAGTIHIQVTSD    631 - 700
VLEQRIVQQVTGILKDAGVNNLTIQVEKEAYFQHMSGLSTGFHDVLAMTKQMESMKYCKDGTYIM         701 - 765
//

Text Mined References (27)

PMID Year Title