Property Summary

NCBI Gene PubMed Count 18
PubMed Score 45.65
PubTator Score 19.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.400 9.1e-03
ependymoma -1.500 1.0e-02
oligodendroglioma -1.700 4.5e-03
osteosarcoma -1.585 3.1e-02
glioblastoma -1.300 7.9e-05
group 3 medulloblastoma -1.600 5.9e-05
cystic fibrosis -1.545 2.0e-05
medulloblastoma, large-cell -1.700 1.0e-04
primitive neuroectodermal tumor -1.200 1.4e-02
lung adenocarcinoma -1.500 1.3e-14
pediatric high grade glioma -1.100 9.2e-05
lung carcinoma -1.300 8.1e-10
Breast cancer -1.700 1.1e-09
gastric carcinoma -3.200 1.7e-02

Gene RIF (13)

PMID Text
25855082 GLUT12 is a versatile transporter: it transports a wide diversity of hexoses, it can work as a Na+ or H+/glucose symporter, and it shows electrogenic properties.
24820014 findings show the level of expression of GLUT12 was significantly higher in Alzheimer's disease compare to aged controls
23396969 Intestinal dehydroascorbic acid (DHA) transport is mediated by the facilitative sugar transporters, GLUT2 and GLUT8
23302780 study provides the first direct evidence for GLUT9 and GLUT12 expression in vascular smooth muscle cells in conjunction with the previously identified GLUT1 and GLUT10
20965718 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
19549745 Translocation of GLUT12 in cultured myoblasts was dependent on activation of PI3-K.
18978678 Observational study of gene-disease association. (HuGE Navigator)
16803853 GLUT4 and GLUT12 were predominantly expressed in type I oxidative fibers; however, GLUT5 was expressed predominantly in type II (white) fibers
16091581 GLUT12 protein was localized to the apical membrane of human and rat distal tubules and collecting ducts. Levels of both GLUT1 and GLUT12 are elevated in animal models of hypertension and diabetic nephropathy.
12914765 Glucose transport properties and hexose affinities of GLUT12.
12890477 expression in adipose tissue
12583599 Embedded in microvillous (maternal-facing) and basal (fetal-facing) membranes of syncytiotrophoblast, main placental barrier layer. (review)

AA Sequence

MVPVENTEGPSLLNQKGTAVETEGSGSRHPPWARGCGMFTFLSSVTAAVSGLLVGYELGIISGALLQIKT      1 - 70
LLALSCHEQEMVVSSLVIGALLASLTGGVLIDRYGRRTAIILSSCLLGLGSLVLILSLSYTVLIVGRIAI     71 - 140
GVSISLSSIATCVYIAEIAPQHRRGLLVSLNELMIVIGILSAYISNYAFANVFHGWKYMFGLVIPLGVLQ    141 - 210
AIAMYFLPPSPRFLVMKGQEGAASKVLGRLRALSDTTEELTVIKSSLKDEYQYSFWDLFRSKDNMRTRIM    211 - 280
IGLTLVFFVQITGQPNILFYASTVLKSVGFQSNEAASLASTGVGVVKVISTIPATLLVDHVGSKTFLCIG    281 - 350
SSVMAASLVTMGIVNLNIHMNFTHICRSHNSINQSLDESVIYGPGNLSTNNNTLRDHFKGISSHSRSSLM    351 - 420
PLRNDVDKRGETTSASLLNAGLSHTEYQIVTDPGDVPAFLKWLSLASLLVYVAAFSIGLGPMPWLVLSEI    421 - 490
FPGGIRGRAMALTSSMNWGINLLISLTFLTVTDLIGLPWVCFIYTIMSLASLLFVVMFIPETKGCSLEQI    491 - 560
SMELAKVNYVKNNICFMSHHQEELVPKQPQKRKPQEQLLECNKLCGRGQSRQLSPET                 561 - 617
//

Text Mined References (20)

PMID Year Title
25855082 2015 Functional characterization of the human facilitative glucose transporter 12 (GLUT12) by electrophysiological methods.
24820014 2014 Expression of the glucose transporter GLUT12 in Alzheimer's disease patients.
23396969 2013 Intestinal dehydroascorbic acid (DHA) transport mediated by the facilitative sugar transporters, GLUT2 and GLUT8.
23302780 2013 Expression of conventional and novel glucose transporters, GLUT1, -9, -10, and -12, in vascular smooth muscle cells.
20965718 2011 Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
19549745 2009 Insulin-stimulated translocation of glucose transporter (GLUT) 12 parallels that of GLUT4 in normal muscle.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
16803853 2006 Hexose transporter mRNAs for GLUT4, GLUT5, and GLUT12 predominate in human muscle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16091581 2006 Renal expression and localization of the facilitative glucose transporters GLUT1 and GLUT12 in animal models of hypertension and diabetic nephropathy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12914765 2003 Glucose transporter GLUT12-functional characterization in Xenopus laevis oocytes.
12890477 2003 Expression of Class III facilitative glucose transporter genes (GLUT-10 and GLUT-12) in mouse and human adipose tissues.
12583599 2002 Placental glucose transfer and fetal growth.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11832379 2002 Identification of a novel glucose transporter-like protein-GLUT-12.
11780753 The extended GLUT-family of sugar/polyol transport facilitators: nomenclature, sequence characteristics, and potential function of its novel members (review).