Property Summary

Ligand Count 35
NCBI Gene PubMed Count 26
PubMed Score 151.54
PubTator Score 65.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
inflammatory breast cancer 286 2.9e-04
medulloblastoma, large-cell 6241 4.0e-03
invasive ductal carcinoma 2951 4.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Mental Depression 333 0.0 1.2
Disease Target Count Z-score Confidence
Obesity 678 4.007 2.0
Melkersson-Rosenthal syndrome 4 3.308 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
inflammatory breast cancer -1.400 2.9e-04
invasive ductal carcinoma -1.100 4.1e-03
medulloblastoma, large-cell -1.200 4.0e-03

Gene RIF (15)

AA Sequence

MRAPGAGAASVVSLALLWLLGLPWTWSAAAALGVYVGSGGWRFLRIVCKTARRDLFGLSVLIRVRLELRR      1 - 70
HQRAGHTIPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLFRQLGFAPGDVVAIFLEGRPE     71 - 140
FVGLWLGLAKAGMEAALLNVNLRREPLAFCLGTSGAKALIFGGEMVAAVAEVSGHLGKSLIKFCSGDLGP    141 - 210
EGILPDTHLLDPLLKEASTAPLAQIPSKGMDDRLFYIYTSGTTGLPKAAIVVHSRYYRMAAFGHHAYRMQ    211 - 280
AADVLYDCLPLYHSAGNIIGVGQCLIYGLTVVLRKKFSASRFWDDCIKYNCTVVQYIGEICRYLLKQPVR    281 - 350
EAERRHRVRLAVGNGLRPAIWEEFTERFGVRQIGEFYGATECNCSIANMDGKVGSCGFNSRILPHVYPIR    351 - 420
LVKVNEDTMELLRDAQGLCIPCQAGEPGLLVGQINQQDPLRRFDGYVSESATSKKIAHSVFSKGDSAYLS    421 - 490
GDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEGVLSRLLGQTDVAVYGVAVPGVEGKAGMAAVADPH    491 - 560
SLLDPNAIYQELQKVLAPYARPIFLRLLPQVDTTGTFKIQKTRLQREGFDPRQTSDRLFFLDLKQGHYLP    561 - 630
LNEAVYTRICSGAFAL                                                          631 - 646
//

Text Mined References (28)

PMID Year Title