Property Summary

NCBI Gene PubMed Count 25
PubMed Score 135.83
PubTator Score 65.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.200 4.0e-03
inflammatory breast cancer -1.400 2.9e-04
invasive ductal carcinoma -1.100 4.1e-03

Gene RIF (14)

PMID Text
25961023 Messenger RNAs for three proteins AATK, SLC27A1, and CDKAL1 are preferentially secreted out in exosomes from HIV-1 Nef-expressing cells, and their targeting miRNAs (miR-32 and miR-93*) are retained in these cells
24120574 Several proteins that are expressed in the epidermis have been proposed to facilitate the uptake of long-chain fatty acids (LCFA) in mammalian cells, CD36, fatty acid binding protein, and FATP. [review]
20965718 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20356843 FATP1 inhibits 11-cis retinol formation via interaction with the visual cycle retinoid isomerase RPE65 and lecithin:retinol acyltransferase
19913121 Observational study of gene-disease association. (HuGE Navigator)
19361580 These data reveals the localization and points to a regulatory function of FATP1 in myotube mitochondria.
18660489 Observational study of gene-disease association. (HuGE Navigator)
15978856 Observational study of gene-disease association. (HuGE Navigator)
15897321 FATP1 stimulated transport and consumption of palmitate and oleate, which they channeled away from complete oxidation and toward TAG synthesis.
12818409 Observational study of gene-disease association. (HuGE Navigator)
12818409 FATP1 might play a role in post-prandial lipid metabolism and development of cardiovascular disease.
12235169 exogenously supplied fatty acids are preferentially channeled by an FATP1-linked mechanism into the TG biosynthetic pathway; such internalized lipids downregulate de novo sphingomyelin and cholesterol metabolism in growing 293 cells

AA Sequence

MRAPGAGAASVVSLALLWLLGLPWTWSAAAALGVYVGSGGWRFLRIVCKTARRDLFGLSVLIRVRLELRR      1 - 70
HQRAGHTIPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLFRQLGFAPGDVVAIFLEGRPE     71 - 140
FVGLWLGLAKAGMEAALLNVNLRREPLAFCLGTSGAKALIFGGEMVAAVAEVSGHLGKSLIKFCSGDLGP    141 - 210
EGILPDTHLLDPLLKEASTAPLAQIPSKGMDDRLFYIYTSGTTGLPKAAIVVHSRYYRMAAFGHHAYRMQ    211 - 280
AADVLYDCLPLYHSAGNIIGVGQCLIYGLTVVLRKKFSASRFWDDCIKYNCTVVQYIGEICRYLLKQPVR    281 - 350
EAERRHRVRLAVGNGLRPAIWEEFTERFGVRQIGEFYGATECNCSIANMDGKVGSCGFNSRILPHVYPIR    351 - 420
LVKVNEDTMELLRDAQGLCIPCQAGEPGLLVGQINQQDPLRRFDGYVSESATSKKIAHSVFSKGDSAYLS    421 - 490
GDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEGVLSRLLGQTDVAVYGVAVPGVEGKAGMAAVADPH    491 - 560
SLLDPNAIYQELQKVLAPYARPIFLRLLPQVDTTGTFKIQKTRLQREGFDPRQTSDRLFFLDLKQGHYLP    561 - 630
LNEAVYTRICSGAFAL                                                          631 - 646
//

Text Mined References (27)

PMID Year Title
25163924 2014 Insulin sensitivity is independent of lipid binding protein trafficking at the plasma membrane in human skeletal muscle: effect of a 3-day, high-fat diet.
24937540 2014 Association between expression of FABPpm in skeletal muscle and insulin sensitivity in intramyocellular lipid-accumulated nonobese men.
24120574 2014 Fatty acid transporters in skin development, function and disease.
24113382 2013 Overexpression of human fatty acid transport protein 2/very long chain acyl-CoA synthetase 1 (FATP2/Acsvl1) reveals distinct patterns of trafficking of exogenous fatty acids.
23528296 2013 Arylpiperazines as fatty acid transport protein 1 (FATP1) inhibitors with improved potency and pharmacokinetic properties.
23024797 2012 Overexpressed FATP1, ACSVL4/FATP4 and ACSL1 increase the cellular fatty acid uptake of 3T3-L1 adipocytes but are localized on intracellular membranes.
20965718 2011 Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20360315 2010 Genome-wide pharmacogenetics of antidepressant response in the GENDEP project.
20356843 2010 FATP1 inhibits 11-cis retinol formation via interaction with the visual cycle retinoid isomerase RPE65 and lecithin:retinol acyltransferase.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19523918 2009 Regulation of cardiolipin biosynthesis by fatty acid transport protein-1 IN HEK 293 cells.
19361580 2009 FATP1 localizes to mitochondria and enhances pyruvate dehydrogenase activity in skeletal myotubes.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
15978856 Lack of association between certain candidate gene polymorphisms and the metabolic syndrome.
15897321 2005 Impact on fatty acid metabolism and differential localization of FATP1 and FAT/CD36 proteins delivered in cultured human muscle cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12818409 2003 A common polymorphism in the fatty acid transport protein-1 gene associated with elevated post-prandial lipaemia and alterations in LDL particle size distribution.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12235169 2002 FATP1 channels exogenous FA into 1,2,3-triacyl-sn-glycerol and down-regulates sphingomyelin and cholesterol metabolism in growing 293 cells.
10873384 2000 The human fatty acid transport protein-1 (SLC27A1; FATP-1) cDNA and gene: organization, chromosomal localization, and expression.
9671728 1998 A family of fatty acid transporters conserved from mycobacterium to man.
7954810 1994 Expression cloning and characterization of a novel adipocyte long chain fatty acid transport protein.