Property Summary

NCBI Gene PubMed Count 12
PubMed Score 677.98
PubTator Score 87.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma -2.172 8.3e-06
ependymoma -1.200 3.3e-05
glioblastoma -1.600 2.6e-04
atypical teratoid / rhabdoid tumor -1.500 2.2e-05
medulloblastoma -1.100 8.8e-03
medulloblastoma, large-cell -1.700 2.5e-04
pancreatic ductal adenocarcinoma liver m... -1.610 2.4e-03
non-small cell lung cancer -1.217 4.2e-15
adult high grade glioma -2.000 1.5e-06
subependymal giant cell astrocytoma 1.249 1.3e-02
Breast cancer 1.400 2.8e-09
ductal carcinoma in situ -1.200 5.4e-03
invasive ductal carcinoma -1.900 8.2e-03
ovarian cancer -2.000 4.0e-09

Gene RIF (4)

PMID Text
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAATAAAALAAADPPPAMPQAAGAGGPTTRRDFYWLRSFLAGGIAGCCAKTTVAPLDRVKVLLQAHNHH      1 - 70
YKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHRLMAGSMA     71 - 140
GMTAVICTYPLDMVRVRLAFQVKGEHSYTGIIHAFKTIYAKEGGFFGFYRGLMPTILGMAPYAGVSFFTF    141 - 210
GTLKSVGLSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKC    211 - 280
LTMRDTMKYVYGHHGIRKGLYRGLSLNYIRCIPSQAVAFTTYELMKQFFHLN                      281 - 332
//

Text Mined References (15)

PMID Year Title
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11158296 2001 The yeast mitochondrial carrier Leu5p and its human homologue Graves' disease protein are required for accumulation of coenzyme A in the matrix.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8444471 1993 Regional assignment of the gene coding for a human Graves' disease autoantigen to 10q21.3-q22.1.
2575220 1989 Sequence and chromosomal assignment of a novel cDNA identified by immunoscreening of a thyroid expression library: similarity to a family of mitochondrial solute carrier proteins.
1457817 1992 Sequence and pattern of expression of a bovine homologue of a human mitochondrial transport protein associated with Grave's disease.