Property Summary

NCBI Gene PubMed Count 56
PubMed Score 323.71
PubTator Score 168.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
Rheumatoid Arthritis -1.100 1.3e-02
malignant mesothelioma 1.400 1.5e-06
lung cancer 2.100 2.5e-05
interstitial cystitis -1.300 1.2e-03
sonic hedgehog group medulloblastoma 1.500 1.3e-06

Protein-protein Interaction (10)

Gene RIF (37)

PMID Text
27129276 In the absence of SLC1A5 there is a crucial role of SNAT1 in supplying glutamine for glutaminolysis with SNAT2 acting as a "backup" for glutamine transport.
26936531 High expression of LAT1 and ASCT2 correlates with metastasis and invasion in esophageal squamous cell carcinoma.
26492990 Cys is a potent competitive inhibitor of hASCT2 but is not a substrate
26024742 LAT1, 4F2hc and ASCT2 were highly expressed in patients with advanced laryngeal cancer.
25987094 Genetic Variants in ASCT2 Gene are Associated with response to therapy in Hepatocelluar Carcinoma
25862406 The results demonstrate that N-glycosylation of SLC1A5 is critical for trafficking.
25693838 ASCT2-mediated glutamine uptake is essential for multiple pathways regulating the cell cycle and cell growth.
25631074 Cellular biotinylated solute carrier family 1 (neutral amino acid transporter), member 5 (SLC1A5) protein is incorporated into HIV-1 Gag virus-like particles
25337245 Report the differential expression of SLC1A5 in human colorectal cancer and normal tissues, and a functional link between SLC1A5 expression and growth and survival of colorectal cancer.
25142020 ASCT2 expression, which correlates with that of N-Myc and ATF4, is markedly elevated in high-stage neuroblastoma
25052780 analysis of the kinetic mechanism of the transport catalyzed by the human glutamine/neutral amino acid transporter hASCT2
24845232 ASCT2 expression plays an important role in tumour cell growth, and is a promising pathological marker for predicting a worse outcome in pancreatic cancer.
24687878 ASCT-2 is expressed in human oocytes.ASCT-2 is localized at the acrosomal region and equatorial segment of the spermatozoa.
24603303 ASC amino-acid transporter 2 expression has a crucial role in the metastasis of pulmonary AC, and is a potential molecular marker for predicting poor prognosis after surgery.
24531984 the expression of LAT1 and ASCT2 is significantly increased in human melanoma. The importance of ASCT2 expression in melanoma was confirmed by shRNA knockdown, which inhibited glutamine uptake, mTORC1 signaling and cell proliferation.
23636801 stromal expression of the glutamine-metabolism-related proteins GLS1, GDH, ASCT2 increases with worsening histological phyllodes tumor grade.
23507704 HER2- type breast cancer had the highest expression of stromal GLS1, tumoral GDH, stromal GDH, and tumoral ASCT, while TNBC had the lowest tumoral GDH expression.
23213057 SLC1A5 plays a key role in Gln transport controlling lung cancer cells' metabolism, growth, and survival.
22804921 These data suggest that intracellular replication of Francisella tularensis depends on the function of host cell SLC1A5.
22238282 Cx43-mediated GJIC and SLC1A5 interaction play important functional roles in trophoblast cell fusion.
19321927 In primary term human trophoblasts, ASCT2 mRNA levels were preserved at normoxia and downregulated at 1% O(2) after 48 h.
18638388 SLC1A5 gene is associated with schizophrenia.
18638388 Observational study of gene-disease association. (HuGE Navigator)
18157695 In human entrocytes, glutamine transport and ASCT2 surface expression induced by short-term EGF are MAPK, PI3K, and Rho-dependent.
17676482 Localisation and distribution of RDR/ASCT2 in human placental villi suggests that the fusion of placental trophoblast cells is not regulated by local or temporal variations of RDR/ASCT2 expression in villous cytotrophoblast cells.
17329400 ASCT2 silencing inhibits mTORC1 (mTOR/raptor) signaling and leads to growth repression, followed by enhanced survival signaling via mTORC2 (mTOR/rictor comples) and apoptosis of hepatoma cells.
16820059 evaluation of the interaction of the HERV-W envelope with the hASCT2 receptor; a region consisting of the N-terminal 124 amino acids of the mature glycoprotein surface subunit was determined as the minimal receptor-binding domain
16516348 the activity of glutamate transporter GLAST/EAAT1 can effectively regulate the cell surface expression of glutamine/neutral amino acid transporter ASCT2 in human fetal astrocytes
16435221 analysis of SLC1A5 mutations on 19q13 in cystinuria patients
16197915 These results show that the stimulation of ASCT2 expression in response to glutamine in part involves binding of FXR/RXR to the ASCT2 promoter.
15848195 up-regulation of ASCT2 by S-nitroso-N-acetyl-DL-penicillamine might be partially associated with an increase in the density of transporter protein via de novo synthesis
14520239 ASCT2 messenger RNA was not altered significantly in hypoxia in cytotrophoblasts or in perfused placental cotyledons.
12757936 Hypoxia alters expression and function of syncytin and its receptor (amino acid transport system B(0)) during trophoblast cell fusion of human placental BeWo cells: implications for impaired trophoblast syncytialisation in pre-eclampsia.
12584318 results strongly suggest that combinations of amino acid sequence changes and N-linked oligosaccharides in a critical carboxyl-terminal region of extracellular loop 2 (ECL2) control retroviral utilization of both the ASCT1 and ASCT2 receptors
12555937 in the six unrelated Hartnup pedigrees studied, examination of linkage at 19q13.3, polymorphisms in the coding sequence and quantitation of expression of SLC1A5 did not suffice to explain the defect in neutral amino acid transport
12175968 level of amino acid transporter B(0)(ACST2) mRNA expression was lower in forskolin treated BeWo cells
12050356 used as receptor by HERV-W Env glycoprotein

AA Sequence

MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVVAVVAGVALGL      1 - 70
GVSGAGGALALGPERLSAFVFPGELLLRLLRMIILPLVVCSLIGGAASLDPGALGRLGAWALLFFLVTTL     71 - 140
LASALGVGLALALQPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRSYSTTYEE    141 - 210
RNITGTRVKVPVGQEVEGMNILGLVVFAIVFGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVG    211 - 280
IMFLVAGKIVEMEDVGLLFARLGKYILCCLLGHAIHGLLVLPLIYFLFTRKNPYRFLWGIVTPLATAFGT    281 - 350
SSSSATLPLMMKCVEENNGVAKHISRFILPIGATVNMDGAALFQCVAAVFIAQLSQQSLDFVKIITILVT    351 - 420
ATASSVGAAGIPAGGVLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTE    421 - 490
SRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESVM                       491 - 541
//

Text Mined References (68)

PMID Year Title
27129276 2016 Deletion of Amino Acid Transporter ASCT2 (SLC1A5) Reveals an Essential Role for Transporters SNAT1 (SLC38A1) and SNAT2 (SLC38A2) to Sustain Glutaminolysis in Cancer Cells.
26936531 2016 Clinicopathological significance of LAT1 and ASCT2 in patients with surgically resected esophageal squamous cell carcinoma.
26492990 2015 Cysteine is not a substrate but a specific modulator of human ASCT2 (SLC1A5) transporter.
26024742 2015 Expression of Amino Acid Transporters (LAT1 and ASCT2) in Patients with Stage III/IV Laryngeal Squamous Cell Carcinoma.
25987094 2015 Genetic Variants in ASCT2 Gene are Associated with the Prognosis of Transarterial Chemoembolisation-Treated Early- Stage Hepatocelluar Carcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25862406 2015 N-linked glycosylation of human SLC1A5 (ASCT2) transporter is critical for trafficking to membrane.
25759021 2015 Regulation of glutamine carrier proteins by RNF5 determines breast cancer response to ER stress-inducing chemotherapies.
25693838 2015 Targeting ASCT2-mediated glutamine uptake blocks prostate cancer growth and tumour development.
25337245 2014 Upregulated SLC1A5 promotes cell growth and survival in colorectal cancer.
25142020 2015 ATF4 and N-Myc coordinate glutamine metabolism in MYCN-amplified neuroblastoma cells through ASCT2 activation.
25052780 2014 Transport mechanism and regulatory properties of the human amino acid transporter ASCT2 (SLC1A5).
24845232 2015 Clinicopathological significance of ASC amino acid transporter-2 expression in pancreatic ductal carcinoma.
24687878 2014 Syncytin-1 and its receptor is present in human gametes.
24603303 2014 ASC amino-acid transporter 2 (ASCT2) as a novel prognostic marker in non-small cell lung cancer.
24531984 2014 Targeting glutamine transport to suppress melanoma cell growth.
23636801 2013 The expression of glutamine-metabolism-related proteins in breast phyllodes tumors.
23507704 2013 Expression of glutamine metabolism-related proteins according to molecular subtype of breast cancer.
23492904 2013 A novel human endogenous retroviral protein inhibits cell-cell fusion.
23213057 2013 SLC1A5 mediates glutamine transport required for lung cancer cell growth and survival.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22804921 2012 Francisella tularensis regulates the expression of the amino acid transporter SLC1A5 in infected THP-1 human monocytes.
22238282 2012 The molecular role of connexin 43 in human trophoblast cell fusion.
21757002 2011 The nuclear receptor FXR regulates hepatic transport and metabolism of glutamine and glutamate.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19321927 2009 Syncytin-1 and glial cells missing a: hypoxia-induced deregulated gene expression along with disordered cell fusion in primary term human trophoblasts.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18638388 2008 Association study of polymorphisms in the neutral amino acid transporter genes SLC1A4, SLC1A5 and the glycine transporter genes SLC6A5, SLC6A9 with schizophrenia.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
18157695 2008 In human entrocytes, GLN transport and ASCT2 surface expression induced by short-term EGF are MAPK, PI3K, and Rho-dependent.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17676482 2007 Distribution of human endogenous retrovirus type W receptor in normal human villous placenta.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17329400 2007 ASCT2 silencing regulates mammalian target-of-rapamycin growth and survival signaling in human hepatoma cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16820059 2006 Identification of the hASCT2-binding domain of the Env ERVWE1/syncytin-1 fusogenic glycoprotein.
16516348 High-affinity glutamate transporter GLAST/EAAT1 regulates cell surface expression of glutamine/neutral amino acid transporter ASCT2 in human fetal astrocytes.
16435221 2005 Search for mutations in SLC1A5 (19q13) in cystinuria patients.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16197915 2005 Identification of the promoter elements involved in the stimulation of ASCT2 expression by glutamine availability in HepG2 cells and the probable involvement of FXR/RXR dimers.
15848195 2005 Functional regulation of Na+-dependent neutral amino acid transporter ASCT2 by S-nitrosothiols and nitric oxide in Caco-2 cells.
15845389 2005 The serine/threonine kinases SGK1, 3 and PKB stimulate the amino acid transporter ASCT2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14520239 2003 Transcriptional effects of hypoxia on fusiogenic syncytin and its receptor ASCT2 in human cytotrophoblast BeWo cells and in ex vivo perfused placental cotyledons.
12757936 2003 Hypoxia alters expression and function of syncytin and its receptor during trophoblast cell fusion of human placental BeWo cells: implications for impaired trophoblast syncytialisation in pre-eclampsia.
12584318 2003 N-linked glycosylation and sequence changes in a critical negative control region of the ASCT1 and ASCT2 neutral amino acid transporters determine their retroviral receptor functions.
12555937 2002 Hartnup disorder: polymorphisms identified in the neutral amino acid transporter SLC1A5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12175968 2002 Changes in expression and function of syncytin and its receptor, amino acid transport system B(0) (ASCT2), in human placental choriocarcinoma BeWo cells during syncytialization.
12050356 2002 The envelope glycoprotein of human endogenous retrovirus type W uses a divergent family of amino acid transporters/cell surface receptors.
11781704 2001 ATB(0)/SLC1A5 gene. Fine localisation and exclusion of association with the intestinal phenotype of cystic fibrosis.
11350958 2001 Truncated forms of the dual function human ASCT2 neutral amino acid transporter/retroviral receptor are translationally initiated at multiple alternative CUG and GUG codons.
10708449 2000 An envelope glycoprotein of the human endogenous retrovirus HERV-W is expressed in the human placenta and fuses cells expressing the type D mammalian retrovirus receptor.
10698697 2000 Neutral amino acid transporter ASCT2 displays substrate-induced Na+ exchange and a substrate-gated anion conductance.
10196349 1999 A sodium-dependent neutral-amino-acid transporter mediates infections of feline and baboon endogenous retroviruses and simian type D retroviruses.
10051606 1999 The RD114/simian type D retrovirus receptor is a neutral amino acid transporter.
8702519 1996 Cloning of the sodium-dependent, broad-scope, neutral amino acid transporter Bo from a human placental choriocarcinoma cell line.