Property Summary

NCBI Gene PubMed Count 33
PubMed Score 53.09
PubTator Score 51.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.400 8.3e-04
atypical teratoid / rhabdoid tumor 1.200 7.0e-03
glioblastoma 1.100 6.2e-03
group 4 medulloblastoma 1.100 1.1e-02
medulloblastoma, large-cell 1.700 7.4e-05
nephrosclerosis -1.432 3.3e-02
ovarian cancer 1.400 1.4e-09

Gene RIF (20)

AA Sequence

MQMDNRLPPKKVPGFCSFRYGLSFLVHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKN      1 - 70
PMYNWSPDIQGIILSSTSYGVIIIQVPVGYFSGIYSTKKMIGFALCLSSVLSLLIPPAAGIGVAWVVVCR     71 - 140
AVQGAAQGIVATAQFEIYVKWAPPLERGRLTSMSTSGFLLGPFIVLLVTGVICESLGWPMVFYIFGACGC    141 - 210
AVCLLWFVLFYDDPKDHPCISISEKEYITSSLVQQVSSSRQSLPIKAILKSLPVWAISTGSFTFFWSHNI    211 - 280
MTLYTPMFINSMLHVNIKENGFLSSLPYLFAWICGNLAGQLSDFFLTRNILSVIAVRKLFTAAGFLLPAI    281 - 350
FGVCLPYLSSTFYSIVIFLILAGATGSFCLGGVFINGLDIAPRYFGFIKACSTLTGMIGGLIASTLTGLI    351 - 420
LKQDPESAWFKTFILMAAINVTGLIFYLIVATAEIQDWAKEKQHTRL                           421 - 467
//

Text Mined References (36)

PMID Year Title