Property Summary

NCBI Gene PubMed Count 9
PubMed Score 8.14
PubTator Score 7.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.278 7.0e-03
active ulcerative colitis 1.052 1.9e-02
atypical teratoid / rhabdoid tumor -1.100 7.1e-04
breast carcinoma 1.300 6.6e-29
cutaneous lupus erythematosus 1.200 1.4e-02
ductal carcinoma in situ 2.400 1.3e-05
ependymoma -1.100 6.7e-03
group 4 medulloblastoma -1.300 3.3e-04
intraductal papillary-mucinous carcinoma... 1.300 2.3e-02
invasive ductal carcinoma 2.000 8.4e-03
malignant mesothelioma -4.100 8.2e-09
non primary Sjogren syndrome sicca 1.400 1.4e-02
non-small cell lung cancer 1.942 6.0e-23
ovarian cancer 4.100 7.7e-05

Gene RIF (5)

AA Sequence

MTQMSQVQELFHEAAQQDALAQPQPWWKTQLFMWEPVLFGTWDGVFTSCMINIFGVVLFLRTGWLVGNTG      1 - 70
VLLGMFLVSFVILVALVTVLSGIGVGERSSIGSGGVYSMISSVLGGQTGGTIGLLYVFGQCVAGAMYITG     71 - 140
FAESISDLLGLGNIWAVRGISVAVLLALLGINLAGVKWIIRLQLLLLFLLAVSTLDFVVGSFTHLDPEHG    141 - 210
FIGYSPELLQNNTLPDYSPGESFFTVFGVFFPAATGVMAGFNMGGDLREPAASIPLGSLAAVGISWFLYI    211 - 280
IFVFLLGAICTREALRYDFLIAEKVSLMGFLFLLGLYISSLASCMGGLYGAPRILQCIAQEKVIPALACL    281 - 350
GQGKGPNKTPVAAICLTSLVTMAFVFVGQVNVLAPIVTINFMLTYVAVDYSYFSLSMCSCSLTPVPEPVL    351 - 420
REGAEGLHCSEHLLLEKAPSYGSEGPAQRVLEGTLLEFTKDMDQLLQLTRKLESSQPRQGEGNRTPESQK    421 - 490
RKSKKATKQTLQDSFLLDLKSPPSFPVEISDRLPAASWEGQESCWNKQTSKSEGTQPEGTYGEQLVPELC    491 - 560
NQSESSGEDFFLKSRLQEQDVWRRSTSFYTHMCNPWVSLLGAVGSLLIMFVIQWVYTLVNMGVAAIVYFY    561 - 630
IGRASPGLHLGSASNFSFFRWMRSLLLPSCRSLRSPQEQIILAPSLAKVDMEMTQLTQENADFATRDRYH    631 - 700
HSSLVNREQLMPHY                                                            701 - 714
//

Text Mined References (13)

PMID Year Title