Property Summary

NCBI Gene PubMed Count 14
PubMed Score 36.66
PubTator Score 21.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 1.2e-30
osteosarcoma 7933 1.5e-08
tuberculosis 1563 1.5e-05
interstitial cystitis 2299 9.9e-04
Disease Target Count Z-score Confidence
Blastomycosis 12 4.235 2.1
Huntington's disease 72 3.356 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -3.407 1.5e-08
tuberculosis -1.400 1.5e-05
interstitial cystitis 1.100 9.9e-04
psoriasis 1.200 1.2e-30

Gene RIF (5)

PMID Text
24018043 SLAP2 SH3 and SH2 domains are separated by a short SH3-SH2 connector sequence.
21044367 Observational study of gene-disease association. (HuGE Navigator)
20828795 In platelets, SLAP-2 may have function as a negative regulator of GPVI-mediated signaling by interacting with c-Cbl.
12527895 The human SLAP-2 gene is located on chromosome 20q, and the SLAP-2 coding region consists of seven exons, a unique cDNA encoding an alternatively spliced SLAP-2 isoform has been identified
11891219 negatively regulates T cell receptor signaling

AA Sequence

MGSLPSRRKSLPSPSLSSSVQGQGPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWWT      1 - 70
VLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPA     71 - 140
SWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYSELADDICCLLKEPCVLQRAGPLPGKDIPLPVTV    141 - 210
QRTPLNWKELDSSLLFSEAATGEESLLSEGLRESLSFYISLNDEAVSLDDA                       211 - 261
//

Text Mined References (14)

PMID Year Title
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24018043 2013 Crystal structure of Src-like adaptor protein 2 reveals close association of SH3 and SH2 domains through ?-sheet formation.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
20828795 2010 Roles of Src-like adaptor protein 2 (SLAP-2) in GPVI-mediated platelet activation SLAP-2 and GPVI signaling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12527895 2003 Cloning and characterization of human Src-like adaptor protein 2 and a novel splice isoform, SLAP-2-v.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12024036 2002 Functional cooperation between c-Cbl and Src-like adaptor protein 2 in the negative regulation of T-cell receptor signaling.
11891219 2002 A novel Src homology 2 domain-containing molecule, Src-like adapter protein-2 (SLAP-2), which negatively regulates T cell receptor signaling.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11696592 2001 Functional cloning of Src-like adapter protein-2 (SLAP-2), a novel inhibitor of antigen receptor signaling.