Property Summary

NCBI Gene PubMed Count 126
PubMed Score 310.07
PubTator Score 184.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.100 4.0e-03
Astrocytoma, Pilocytic -1.100 1.4e-06
atypical teratoid / rhabdoid tumor -1.700 5.5e-08
Breast cancer 3.400 3.8e-02
esophageal adenocarcinoma -1.200 2.3e-02
glioblastoma -1.200 3.8e-07
medulloblastoma -1.100 4.1e-07
medulloblastoma, large-cell -1.800 3.0e-05
Multiple myeloma 1.886 6.3e-04
ovarian cancer -1.700 5.5e-07
primary pancreatic ductal adenocarcinoma 1.061 1.5e-03
subependymal giant cell astrocytoma -1.566 2.4e-02

PDB (19)

Gene RIF (31)

AA Sequence

MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPP      1 - 70
PPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFN     71 - 140
IKNDFTEEEEAQVRKENQWCEEK                                                   141 - 163
//

Text Mined References (139)

PMID Year Title