Property Summary

NCBI Gene PubMed Count 126
PubMed Score 310.07
PubTator Score 184.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.100 4.0e-03
Astrocytoma, Pilocytic -1.100 1.4e-06
atypical teratoid / rhabdoid tumor -1.700 5.5e-08
Breast cancer 3.400 3.8e-02
esophageal adenocarcinoma -1.200 2.3e-02
glioblastoma -1.200 3.8e-07
medulloblastoma -1.100 4.1e-07
medulloblastoma, large-cell -1.800 3.0e-05
Multiple myeloma 1.886 6.3e-04
ovarian cancer -1.700 5.5e-07
primary pancreatic ductal adenocarcinoma 1.061 1.5e-03
subependymal giant cell astrocytoma -1.566 2.4e-02

Synonym

Accession P63208 D3DQ97 D3DQ98 P34991 Q8TAY2
Symbols OCP2
p19A
EMC19
SKP1A
OCP-II
TCEB1L

Gene

PDB

4I6J   3L2O   1LDK   5JH5   5IBK   1FQV   1FS1   1FS2   1P22   2ASS   2AST   2E31   2E32   2OVP   2OVQ   2OVR   3WSO   5K35   5V4B  

  Ortholog (1)

Species Source Disease
Macaque EggNOG Inparanoid

Gene RIF (31)

AA Sequence

MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPP      1 - 70
PPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFN     71 - 140
IKNDFTEEEEAQVRKENQWCEEK                                                   141 - 163
//

Text Mined References (139)

PMID Year Title