Property Summary

NCBI Gene PubMed Count 36
PubMed Score 20.57
PubTator Score 48.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Melanoma 261
Disease Target Count P-value
malignant mesothelioma 3163 7.3e-06
osteosarcoma 7933 5.5e-04
Disease Target Count Z-score Confidence
Breast cancer 3098 3.274 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.400 7.3e-06
osteosarcoma -1.450 5.5e-04

Protein-protein Interaction (5)

Gene RIF (25)

PMID Text
25352027 Our results indicate, for the first time, that the SIPA1 -313A>G may have a prognostic role in unresected NSCLC making it a potential predictor of poor survival due to earlier progression.
24704834 nuclear SIPA1 contributes to breast cancer cell invasion through the regulation of integrin beta1 signaling.
24260471 BRD4 short isoform interacts with RRP1B, SIPA1 and components of the LINC complex at the inner face of the nuclear membrane.
24006220 This meta-analysis suggests that rs746429 is associated with the risk of breast cancer.
23771732 SIPA1 SNPs, rs746429 and rs2306364, were associated with decreased risk of triple-negative breast tumors.
23661532 Polymorphism in Sipa1 promoter gene is associated with lung cancer.
23358895 Patients with metastatic breast cancer with SIPA1 545 T/T genotype had a significantly worse overall survival than did patients with C/T or C/C genotype (50.0% vs. 62.9%, P = 0.042).
22990111 SIPA1 expression is increased in human colorectal cancer.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19906411 In this case-control study, SNPs in SIPA1 varied statistically in cervical cancer patients with and without nodal metastases and in MMP9 after controlling for stage and lymphvascular space invasion.
19906411 Observational study of gene-disease association. (HuGE Navigator)
19825179 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19765277 SIPA1 SNP rs3741378 was associated with increased breast cancer incidence.
19765277 Observational study of gene-disease association. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
19089925 Our results do not support a relationship between SIPA1 polymorphisms and breast cancer risk or subsequent survival
19089925 Observational study of gene-disease association. (HuGE Navigator)
18492118 it is unlikely that SIPA1 plays a pathogenetic role in the development of juvenile myelomonocytic leukemia
18033671 SPA1 regulates the maintenance and differentiation of embryonic stem cells.
16563182 Observational study of gene-disease association. (HuGE Navigator)
16563182 SIPA1 germline polymorphisms are associated with aggressive disease behavior in breast cancer.
15456879 Data identif a Rap GTPase-activating protein, signal-induced proliferation-associated protein 1 (SPA-1), as a factor that interacts with Brd4.
12091396 role in regulating phorbol 12-myristate 13-acetate-stimulated but not ligand-induced beta 1 integrin-dependent leukocyte adhesion

AA Sequence

MPMWAGGVGSPRRGMAPASTDDLFARKLRQPARPPLTPHTFEPRPVRGPLLRSGSDAGEARPPTPASPRA      1 - 70
RAHSHEEASRPAATSTRLFTDPLALLGLPAEEPEPAFPPVLEPRWFAHYDVQSLLFDWAPRSQGMGSHSE     71 - 140
ASSGTLASAEDQAASSDLLHGAPGFVCELGGEGELGLGGPASPPVPPALPNAAVSILEEPQNRTSAYSLE    141 - 210
HADLGAGYYRKYFYGKEHQNFFGMDESLGPVAVSLRREEKEGSGGGTLHSYRVIVRTTQLRTLRGTISED    211 - 280
ALPPGPPRGLSPRKLLEHVAPQLSPSCLRLGSASPKVPRTLLTLDEQVLSFQRKVGILYCRAGQGSEEEM    281 - 350
YNNQEAGPAFMQFLTLLGDVVRLKGFESYRAQLDTKTDSTGTHSLYTTYQDHEIMFHVSTMLPYTPNNQQ    351 - 420
QLLRKRHIGNDIVTIVFQEPGSKPFCPTTIRSHFQHVFLVVRAHTPCTPHTTYRVAVSRTQDTPAFGPAL    421 - 490
PAGGGPFAANADFRAFLLAKALNGEQAAGHARQFHAMATRTRQQYLQDLATNEVTTTSLDSASRFGLPSL    491 - 560
GGRRRAAPRGPGAELQAAGSLVWGVRAAPGARVAAGAQASGPEGIEVPCLLGISAEALVLVAPRDGRVVF    561 - 630
NCACRDVLAWTFSEQQLDLYHGRGEAITLRFDGSPGQAVGEVVARLQLVSRGCETRELALPRDGQGRLGF    631 - 700
EVDAEGFVTHVERFTFAETAGLRPGARLLRVCGQTLPSLRPEAAAQLLRSAPKVCVTVLPPDESGRPRRS    701 - 770
FSELYTLSLQEPSRRGAPDPVQDEVQGVTLLPTTKQLLHLCLQDGGSPPGPGDLAEERTEFLHSQNSLSP    771 - 840
RSSLSDEAPVLPNTTPDLLLATTAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLR    841 - 910
NSISRIMSEAGSGTLEDEWQAISEIASTCNTILESLSREGQPIPESGDPKGTPKSDAEPEPGNLSEKVSH    911 - 980
LESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAESESAATRLLLASKQLGSPTADLA            981 - 1042
//

Text Mined References (43)

PMID Year Title
25352027 2015 The SIPA1 -313A>G polymorphism is associated with prognosis in inoperable non-small cell lung cancer.
24704834 2015 Nuclear SIPA1 activates integrin ?1 promoter and promotes invasion of breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24260471 2013 BRD4 short isoform interacts with RRP1B, SIPA1 and components of the LINC complex at the inner face of the nuclear membrane.
24006220 2014 The association of SIPA1 gene polymorphisms with breast cancer risk: evidence from published studies.
23771732 2013 Case-only analyses of the associations between polymorphisms in the metastasis-modifying genes BRMS1 and SIPA1 and breast tumor characteristics, lymph node metastasis, and survival.
23661532 2013 Sipa1 promoter polymorphism predicts risk and metastasis of lung cancer in Chinese.
23358895 2013 Association of SIPA1 545 C > T polymorphism with survival in Chinese women with metastatic breast cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22990111 Expression of signal-induced proliferation-associated gene 1 (SIPA1), a RapGTPase-activating protein, is increased in colorectal cancer and has diverse effects on functions of colorectal cancer cells.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19906411 2010 Polymorphisms in MMP9 and SIPA1 are associated with increased risk of nodal metastases in early-stage cervical cancer.
19825179 2009 Distinct inherited metastasis susceptibility exists for different breast cancer subtypes: a prognosis study.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19765277 2009 Polymorphisms of the SIPA1 gene and sporadic breast cancer susceptibility.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19089925 2009 Genetic variation in SIPA1 in relation to breast cancer risk and survival after breast cancer diagnosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18492118 2008 Mutation analysis of SIPA1 in patients with juvenile myelomonocytic leukemia.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18033671 2008 Spa-1 regulates the maintenance and differentiation of human embryonic stem cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16563182 2006 Germline polymorphisms in SIPA1 are associated with metastasis and other indicators of poor prognosis in breast cancer.
16076873 2005 Multiple roles of Rap1 in hematopoietic cells: complementary versus antagonistic functions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456879 2004 Bromodomain protein Brd4 binds to GTPase-activating SPA-1, modulating its activity and subcellular localization.
12590145 2003 AF-6 controls integrin-mediated cell adhesion by regulating Rap1 activation through the specific recruitment of Rap1GTP and SPA-1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12091396 2002 The GTPase Rap1 regulates phorbol 12-myristate 13-acetate-stimulated but not ligand-induced beta 1 integrin-dependent leukocyte adhesion.
12059963 2002 SPAL, a Rap-specific GTPase activating protein, is present in the NMDA receptor-PSD-95 complex in the hippocampus.
11461903 2001 The phytochrome A-specific signaling intermediate SPA1 interacts directly with COP1, a constitutive repressor of light signaling in Arabidopsis.
10373454 1999 Rap1 GTPase-activating protein SPA-1 negatively regulates cell adhesion.
9651531 1998 Genomic organization and cloning of the human homologue of murine Sipa-1.
9346962 1997 Human SPA-1 gene product selectively expressed in lymphoid tissues is a specific GTPase-activating protein for Rap1 and Rap2. Segregate expression profiles from a rap1GAP gene product.
9183624 1996 [Regulatory mechanisms of lymphocyte proliferation: roles of Spa-1 gene].
9027487 1997 Mitogen-inducible SIPA1 is mapped to the conserved syntenic groups of chromosome 19 in mouse and chromosome 11q13.3 centromeric to BCL1 in human.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7799964 1995 Molecular cloning of a novel mitogen-inducible nuclear protein with a Ran GTPase-activating domain that affects cell cycle progression.