Property Summary

NCBI Gene PubMed Count 3
PubMed Score 6.12
PubTator Score 2.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
interstitial cystitis 2299 5.0e-04
ductal carcinoma in situ 1745 1.7e-02
Breast cancer 3098 3.5e-02
Disease Target Count Z-score Confidence
Osteopetrosis 40 3.512 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 2.500 3.5e-02
interstitial cystitis -1.500 5.0e-04
ductal carcinoma in situ 1.400 1.7e-02

Gene RIF (1)

PMID Text
23035012 Siglec-15 recognizes the tumoral sTn antigen and transduces a signal for enhanced TGF-beta secretion in TAMs

AA Sequence

MEKSIWLLACLAWVLPTGSFVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPH      1 - 70
RHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRY     71 - 140
FCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAA    141 - 210
VRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGASTVALLLGALGFKALLLLG    211 - 280
VLAARAARRRPEHLDTPDTPPRSQAQESNYENLSQMNPRSPPATMCSP                          281 - 328
//

Text Mined References (5)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23035012 2013 The interaction between Siglec-15 and tumor-associated sialyl-Tn antigen enhances TGF-? secretion from monocytes/macrophages through the DAP12-Syk pathway.
17483134 2007 Siglec-15: an immune system Siglec conserved throughout vertebrate evolution.
16177791 2005 DNA sequence and analysis of human chromosome 18.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.