Property Summary

NCBI Gene PubMed Count 3
PubMed Score 6.27
PubTator Score 2.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
interstitial cystitis 2312 9.9e-03
ductal carcinoma in situ 1745 1.7e-02
Breast cancer 3578 3.5e-02
Disease Target Count Z-score Confidence
Osteopetrosis 43 3.53 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 2.500 3.5e-02
ductal carcinoma in situ 1.400 1.7e-02
interstitial cystitis -1.100 9.9e-03

Gene RIF (1)

AA Sequence

MEKSIWLLACLAWVLPTGSFVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPH      1 - 70
RHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRY     71 - 140
FCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAA    141 - 210
VRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGASTVALLLGALGFKALLLLG    211 - 280
VLAARAARRRPEHLDTPDTPPRSQAQESNYENLSQMNPRSPPATMCSP                          281 - 328
//

Text Mined References (5)

PMID Year Title