Property Summary

NCBI Gene PubMed Count 12
PubMed Score 11.69
PubTator Score 12.87

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.229 2.0e-07
medulloblastoma, large-cell -1.200 2.0e-03
tuberculosis and treatment for 3 months 2.000 1.5e-06
interstitial cystitis 1.800 1.0e-02
primary Sjogren syndrome 1.400 2.4e-03
invasive ductal carcinoma 1.300 1.5e-03

Gene RIF (4)

PMID Text
25450598 Siglec-10 is associated with decreased survival and impaired NK cell function in human hepatocellular carcinoma (HCC).
20237496 Observational study of gene-disease association. (HuGE Navigator)
19861682 Siglec-10-VAP-1 interaction seems to mediate lymphocyte adhesion to endothelium
17672918 the apparent occurrence of an unusual TG 3' splice site in intron 11 is discussed

AA Sequence

MLLPLLLSSLLGGSQAMDGRFWIRVQESVMVPEGLCISVPCSFSYPRQDWTGSTPAYGYWFKAVTETTKG      1 - 70
APVATNHQSREVEMSTRGRFQLTGDPAKGNCSLVIRDAQMQDESQYFFRVERGSYVRYNFMNDGFFLKVT     71 - 140
ALTQKPDVYIPETLEPGQPVTVICVFNWAFEECPPPSFSWTGAALSSQGTKPTTSHFSVLSFTPRPQDHN    141 - 210
TDLTCHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYLEAQKGQFLRLLCAADS    211 - 280
QPPATLSWVLQNRVLSSSHPWGPRPLGLELPGVKAGDSGRYTCRAENRLGSQQRALDLSVQYPPENLRVM    281 - 350
VSQANRTVLENLGNGTSLPVLEGQSLCLVCVTHSSPPARLSWTQRGQVLSPSQPSDPGVLELPRVQVEHE    351 - 420
GEFTCHARHPLGSQHVSLSLSVHYSPKLLGPSCSWEAEGLHCSCSSQASPAPSLRWWLGEELLEGNSSQD    421 - 490
SFEVTPSSAGPWANSSLSLHGGLSSGLRLRCEAWNVHGAQSGSILQLPDKKGLISTAFSNGAFLGIGITA    491 - 560
LLFLCLALIIMKILPKRRTQTETPRPRFSRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPS    561 - 630
PESKKNQKKQYQLPSFPEPKSSTQAPESQESQEELHYATLNFPGVRPRPEARMPKGTQADYAEVKFQ       631 - 697
//

Text Mined References (14)

PMID Year Title
25450598 2015 Siglec-10 is associated with survival and natural killer cell dysfunction in hepatocellular carcinoma.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19861682 2009 Human Siglec-10 can bind to vascular adhesion protein-1 and serves as its substrate.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12163025 2002 Cloning of two new splice variants of Siglec-10 and mapping of the interaction between Siglec-10 and SHP-1.
11409878 2001 Molecular characterization, tissue expression, and mapping of a novel Siglec-like gene (SLG2) with three splice variants.
11358961 2001 Cloning and characterization of Siglec-10, a novel sialic acid binding member of the Ig superfamily, from human dendritic cells.
11284738 2001 Identification, characterization and leucocyte expression of Siglec-10, a novel human sialic acid-binding receptor.