Property Summary

NCBI Gene PubMed Count 35
PubMed Score 69.55
PubTator Score 24.54

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.600 1.3e-03
astrocytic glioma -1.400 1.6e-02
ependymoma -1.300 3.7e-02
glioblastoma -1.200 1.2e-03
group 4 medulloblastoma -1.900 7.9e-05
medulloblastoma, large-cell -1.800 4.6e-05
osteosarcoma -2.265 1.4e-05
ovarian cancer 1.700 5.2e-07
psoriasis -1.600 1.3e-04

Gene RIF (25)

AA Sequence

MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWV      1 - 70
KANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHVAAVLASLLVLLALLLAALLYV     71 - 140
KCRLNVLLWYQDAYGEVEINDGKLYDAYVSYSDCPEDRKFVNFILKPQLERRRGYKLFLDDRDLLPRAEP    141 - 210
SADLLVNLSRCRRLIVVLSDAFLSRAWCSHSFREGLCRLLELTRRPIFITFEGQRRDPAHPALRLLRQHR    211 - 280
HLVTLLLWRPGSVTPSSDFWKEVQLALPRKVQYRPVEGDPQTQLQDDKDPMLILRGRVPEGRALDSEVDP    281 - 350
DPEGDLGVRGPVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM              351 - 410
//

Text Mined References (37)

PMID Year Title