Property Summary

NCBI Gene PubMed Count 6
PubMed Score 256.84
PubTator Score 11.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (4)

Disease log2 FC p
group 4 medulloblastoma 1.100 4.8e-02
posterior fossa group B ependymoma -1.100 2.6e-04
psoriasis -1.100 4.0e-40
subependymal giant cell astrocytoma -1.645 3.1e-02

Gene RIF (1)

AA Sequence

MQQEGGPVRSAPCRTGTLEGSRQGSPGHRKRASPKGSLSSAQPHSWMLTPSPLNSHCAHREPISSSPQPV      1 - 70
ANGPKQKKKSNWRSTTRLRIIRLRDRLEPRPLAILEDYADPFDVQETGEGSAGASGAPEKVPENDGYMEP     71 - 140
YEAQKMMAEIRGSKETATQPLPLYDTPYEPEEDGATAEGEGAPWPRESRLPEDDERPPEEYDQPWEWKKE    141 - 210
RISKAFAVDIKVIKDLPWPPPVGQLDSSPSLPDGDRDISGPASPLPEPSLEDSSAQFEGPEKSCLSPGRE    211 - 280
EKGRLPPRLSAGNPKSAKPLSMEPSSPLGEWTDPALPLENQVWYHGAISRTDAENLLRLCKEASYLVRNS    281 - 350
ETSKNDFSLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVAI    351 - 420
RTL                                                                       421 - 423
//

Text Mined References (8)

PMID Year Title