Property Summary

NCBI Gene PubMed Count 6
PubMed Score 39.45
PubTator Score 4.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 3.4e-15
group 4 medulloblastoma 1875 8.0e-08
pilocytic astrocytoma 3086 1.1e-03
oligodendroglioma 2849 7.5e-03
astrocytic glioma 2241 3.4e-02
Disease Target Count Z-score Confidence
Kidney angiomyolipoma 8 3.191 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.800 3.4e-02
oligodendroglioma 2.500 7.5e-03
group 4 medulloblastoma 2.300 8.0e-08
pilocytic astrocytoma 1.100 1.1e-03
psoriasis 3.700 3.4e-15

AA Sequence

MAKWLRDYLSFGGRRPPPQPPTPDYTESDILRAYRAQKNLDFEDPYEDAESRLEPDPAGPGDSKNPGDAK      1 - 70
YGSPKHRLIKVEAADMARAKALLGGPGEELEADTEYLDPFDAQPHPAPPDDGYMEPYDAQWVMSELPGRG     71 - 140
VQLYDTPYEEQDPETADGPPSGQKPRQSRMPQEDERPADEYDQPWEWKKDHISRAFAVQFDSPEWERTPG    141 - 210
SAKELRRPPPRSPQPAERVDPALPLEKQPWFHGPLNRADAESLLSLCKEGSYLVRLSETNPQDCSLSLRS    211 - 280
SQGFLHLKFARTRENQVVLGQHSGPFPSVPELVLHYSSRPLPVQGAEHLALLYPVVTQTP              281 - 340
//

Text Mined References (6)

PMID Year Title
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9315092 1997 Identification and characterization of two novel SH2 domain-containing proteins from a yeast two hybrid screen with the ABL tyrosine kinase.