Property Summary

NCBI Gene PubMed Count 32
PubMed Score 88.54
PubTator Score 34.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma -5.100 2.1e-09
astrocytic glioma -3.200 3.9e-03
ependymoma -3.500 2.3e-02
glioblastoma -1.700 4.9e-02
osteosarcoma 1.103 3.3e-05
medulloblastoma -3.800 4.9e-06
cystic fibrosis 3.129 1.5e-07
medulloblastoma, large-cell -5.000 4.6e-05
primitive neuroectodermal tumor -2.500 2.8e-02
adrenocortical carcinoma -2.350 8.1e-04
non-small cell lung cancer -1.687 6.1e-20
intraductal papillary-mucinous adenoma (... -1.700 3.1e-03
intraductal papillary-mucinous carcinoma... -1.400 4.5e-02
lung cancer -1.200 7.6e-04
lung adenocarcinoma -1.200 5.0e-09
adult high grade glioma -1.400 4.9e-02
lung carcinoma -1.600 3.8e-14
progressive supranuclear palsy 1.200 1.4e-02
invasive ductal carcinoma -1.400 2.1e-02
pituitary cancer 1.500 1.9e-02

Synonym

Accession Q92529 Q5T7I7 Q8TAP2 Q9UCX5
Symbols RAI
NSHC
SHCC
N-Shc

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (17)

PMID Text
25062668 High SHC3 expression is associated with glioblastoma.
22311806 Rai (ShcC/N-Shc), a member of the family of Shc-like adaptor proteins, as a new regulator of migration of normal and cancer stem/progenitor cells.
21046104 Polymorphism in RAI and CD3EAP are associated with outcome of myeloma patients treated with high dose treatment.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19748727 amplification of SHC3 and EDG3 genes suggests that the two proteins co-operate and are important for ependymomas in vivo.
18997821 ShcC is a therapeutic target that might induce differentiation in the aggressive type of neuroblastomas.
17919311 shcc is expressed in the human gut, especially in the enteric glial cells
17179996 Observational study of gene-disease association. (HuGE Navigator)
17179996 11 SNPs within SHC3 were examined to determine the association with nicotine dependence (ND) in either African-Americans (AA) or European-Americans (EA); three SNPs for AAs and one for EAs were significantly associated with at least one ND.
16436505 HIV-1 Tat-induced small GTPase Ras activation is mediated by tyrosine phosphorylation of Shc and recruitment of Grb2 in human endothelial cells
15940252 data suggest that RAI (ShcC/H-Shc)is a critical substrate for RET oncoproteins in thyroid carcinomas
15870690 The inappropriate in vivo expression of Shc3 in high-grade glioma may contribute to the survival of the cancer cells.
15735675 ShcC has phosphotyrosine-dependent and -independent functions in neuroblastoma cells
12242309 The neuron-specific Rai (ShcC) adaptor protein inhibits apoptosis by coupling Ret to the phosphatidylinositol 3-kinase/Akt signaling pathway.
12185581 ALK-ShcC signal activation, possibly caused by co-amplification with the N-myc gene, might give additional effects on malignant tumor progression of neuroblastoma.ShcC is a potent substrate of the activated ALK kinase.
11877420 Tyrosine phosphorylation of the beta-amyloid precursor protein cytoplasmic tail promotes interaction with Shc.
9325171 HIV-1 Tat-induced small GTPase Ras activation is mediated by tyrosine phosphorylation of Shc and recruitment of Grb2 in human endothelial cells

AA Sequence

MLPRTKYNRFRNDSVTSVDDLLHSLSVSGGGGKVSAARATPAAAPYLVSGEALRKAPDDGPGSLGHLLHK      1 - 70
VSHLKLSSSGLRGLSSAARERAGARLSGSCSAPSLAAPDGSAPSAPRAPAMSAARKGRPGDEPLPRPPRG     71 - 140
APHASDQVLGPGVTYVVKYLGCIEVLRSMRSLDFSTRTQITREAISRVCEAVPGAKGAFKKRKPPSKMLS    141 - 210
SILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIANHHMRSISFASGGDPDTTDYVAYVAKDPVNRRAC    211 - 280
HILECCDGLAQDVIGSIGQAFELRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSDHPYYNSIPSKMP    281 - 350
PPGGFLDTRLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYSTPEGKLHVAPTGE    351 - 420
APTYVNTQQIPPQAWPAAVSSAESSPRKDLFDMKPFEDALKNQPLGPVLSKAASVECISPVSPRAPDAKM    421 - 490
LEELQAETWYQGEMSRKEAEGLLEKDGDFLVRKSTTNPGSFVLTGMHNGQAKHLLLVDPEGTIRTKDRVF    491 - 560
DSISHLINHHLESSLPIVSAGSELCLQQPVERKQ                                        561 - 594
//

Text Mined References (33)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25062668 2014 Cell density modulates SHC3 expression and survival of human glioblastoma cells through Fak activation.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
22331829 2012 Genetic determinants of statin-induced low-density lipoprotein cholesterol reduction: the Justification for the Use of Statins in Prevention: an Intervention Trial Evaluating Rosuvastatin (JUPITER) trial.
22311806 2012 Rai is a new regulator of neural progenitor migration and glioblastoma invasion.
21046104 2011 The importance of a sub-region on chromosome 19q13.3 for prognosis of multiple myeloma patients after high-dose treatment and stem cell support: a linkage disequilibrium mapping in RAI and CD3EAP.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19748727 2010 EDG3 and SHC3 on chromosome 9q22 are co-amplified in human ependymomas.
18997821 2009 Distinct role of ShcC docking protein in the differentiation of neuroblastoma.
17919311 2008 Expression of the Rai (Shc C) adaptor protein in the human enteric nervous system.
17179996 2007 Linkage and association studies in African- and Caucasian-American populations demonstrate that SHC3 is a novel susceptibility locus for nicotine dependence.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
15940252 2005 RAI(ShcC/N-Shc)-dependent recruitment of GAB 1 to RET oncoproteins potentiates PI 3-K signalling in thyroid tumors.
15870690 2005 Shc3 affects human high-grade astrocytomas survival.
15735675 2005 Domain-specific function of ShcC docking protein in neuroblastoma cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446789 2002 Grit, a GTPase-activating protein for the Rho family, regulates neurite extension through association with the TrkA receptor and N-Shc and CrkL/Crk adapter molecules.
12242309 2002 The neuron-specific Rai (ShcC) adaptor protein inhibits apoptosis by coupling Ret to the phosphatidylinositol 3-kinase/Akt signaling pathway.
12185581 2002 Activation of anaplastic lymphoma kinase is responsible for hyperphosphorylation of ShcC in neuroblastoma cell lines.
12006576 2002 ShcB and ShcC activation by the Trk family of receptor tyrosine kinases.
11877420 2002 Tyrosine phosphorylation of the beta-amyloid precursor protein cytoplasmic tail promotes interaction with Shc.
11812778 2002 Two adaptor proteins differentially modulate the phosphorylation and biophysics of Kv1.3 ion channel by SRC kinase.
11520933 2001 Nerve growth factor signaling, neuroprotection, and neural repair.
9690470 1998 The structural basis of the activation of Ras by Sos.
9507002 1998 N-Shc and Sck, two neuronally expressed Shc adapter homologs. Their differential regional expression in the brain and roles in neurotrophin and Src signaling.
9345034 1997 Signal transduction in human hematopoietic cells by vascular endothelial growth factor related protein, a novel ligand for the FLT4 receptor.
8808684 1996 N-Shc: a neural-specific adapter molecule that mediates signaling from neurotrophin/Trk to Ras/MAPK pathway.
8760305 1996 A family of Shc related proteins with conserved PTB, CH1 and SH2 regions.
8610109 1996 A mammalian adaptor protein with conserved Src homology 2 and phosphotyrosine-binding domains is related to Shc and is specifically expressed in the brain.
7739560 1995 Insulin-stimulated disassociation of the SOS-Grb2 complex.