Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.71
PubTator Score 3.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer -1.900 3.1e-13
intraductal papillary-mucinous adenoma (... 1.500 9.7e-03
intraductal papillary-mucinous carcinoma... 1.200 3.9e-02
intraductal papillary-mucinous neoplasm ... 1.700 2.1e-02
lung carcinoma -1.200 1.9e-22
ovarian cancer -1.200 9.8e-04
spina bifida -1.218 1.9e-02
ulcerative colitis -1.600 7.7e-04

Gene RIF (2)

AA Sequence

MDDLTLLDLLECPVCFEKLDVTAKVLPCQHTFCKPCLQRVFKAHKELRCPECRTPVFSNIEALPANLLLV      1 - 70
RLLDGVRSGQSSGRGGSFRRPGTMTLQDGRKSRTNPRRLQASPFRLVPNVRIHMDGVPRAKALCNYRGQN     71 - 140
PGDLRFNKGDIILLRRQLDENWYQGEINGISGNFPASSVEVIKQLPQPPPLCRALYNFDLRGKDKSENQD    141 - 210
CLTFLKDDIITVISRVDENWAEGKLGDKVGIFPILFVEPNLTARHLLEKNKGRQSSRTKNLSLVSSSSRG    211 - 280
NTSTLRRGPGSRRKVPGQFSITTALNTLNRMVHSPSGRHMVEISTPVLISSSNPSVITQPMEKADVPSSC    281 - 350
VGQVSTYHPAPVSPGHSTAVVSLPGSQQHLSANMFVALHSYSAHGPDELDLQKGEGVRVLGKCQDGWLRG    351 - 420
VSLVTGRVGIFPNNYVIPIFRKTSSFPDSRSPGLYTTWTLSTSSVSSQGSISEGDPRQSRPFKSVFVPTA    421 - 490
IVNPVRSTAGPGTLGQGSLRKGRSSMRKNGSLQRPLQSGIPTLVVGSLRRSPTMVLRPQQFQFYQPQGIP    491 - 560
SSPSAVVVEMGSKPALTGEPALTCISRGSEAWIHSAASSLIMEDKEIPIKSEPLPKPPASAPPSILVKPE    561 - 630
NSRNGIEKQVKTVRFQNYSPPPTKHYTSHPTSGKPEQPATLKASQPEAASLGPEMTVLFAHRSGCHSGQQ    631 - 700
TDLRRKSALGKATTLVSTASGTQTVFPSK                                             701 - 729
//

Text Mined References (12)

PMID Year Title