Property Summary

NCBI Gene PubMed Count 36
PubMed Score 9.87
PubTator Score 5.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -3.200 2.3e-07
astrocytic glioma -2.800 5.3e-03
Astrocytoma, Pilocytic -4.500 6.5e-16
atypical teratoid / rhabdoid tumor -3.400 3.5e-10
cystic fibrosis -1.400 7.7e-04
ependymoma -2.600 1.3e-02
glioblastoma -3.000 1.0e-07
malignant mesothelioma 2.100 1.1e-05
medulloblastoma -1.200 2.1e-02
medulloblastoma, large-cell -2.900 3.1e-06
non-small cell lung cancer -1.395 7.6e-11
oligodendroglioma -2.200 1.4e-02
osteosarcoma -1.344 9.2e-03
periodontitis -1.400 5.4e-26
Pick disease -1.800 5.5e-03
pituitary cancer 2.600 1.1e-04
primitive neuroectodermal tumor -2.100 9.9e-04
psoriasis 1.300 8.4e-32
spina bifida -2.338 3.6e-02
subependymal giant cell astrocytoma -3.774 5.9e-03

Protein-protein Interaction (1)

Gene RIF (6)

AA Sequence

MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGM      1 - 70
LNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFI     71 - 140
DPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVE    141 - 210
QVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTG    211 - 280
SNIPMDQPCCRGLYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ       281 - 347
//

Text Mined References (40)

PMID Year Title