Property Summary

NCBI Gene PubMed Count 18
PubMed Score 4.55
PubTator Score 21.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Astrocytoma, Pilocytic 1.400 3.1e-05
atypical teratoid / rhabdoid tumor 1.100 3.8e-02
Breast cancer 2.500 2.8e-02
Down syndrome 1.400 8.5e-04
esophageal adenocarcinoma 1.300 2.7e-02
glioblastoma 1.400 7.1e-07
group 3 medulloblastoma 1.500 4.0e-03
lung cancer 1.300 2.9e-03
non primary Sjogren syndrome sicca 1.300 3.1e-02
ovarian cancer -1.900 1.9e-05
pediatric high grade glioma 1.400 6.0e-05
posterior fossa group A ependymoma 1.100 4.2e-06
primary pancreatic ductal adenocarcinoma -1.058 5.5e-03
primitive neuroectodermal tumor 1.800 7.7e-04

Gene RIF (4)

AA Sequence

MAAQRIRAANSNGLPRCKSEGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTN      1 - 70
FTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLNYRNSTLSDSGMIDNLPDSPDEVAKELE     71 - 140
LLGGWTDDKKVPGRMYSNNPFWNGVQTNPFLNGNVPVMPSLDELNPKSTVDLLLFDAGTSSFTESSSATT    141 - 210
NSTGNIFDELPVTNGLHAEPPVRRDNPFFRSKRSYSLSELSVLQAKSDAPTSSSFFTGLKSPAPEQFQSR    211 - 280
EDFRTAWLNHRKLARSCHDLDLLGQSPGWGQTQAVETNIVCKLDSSGGAVQLPDTSISIHVPEGHVAPGE    281 - 350
TQQISMKALLDPPLELNSDRSCSISPVLEVKLSNLEVKTSIILEMKVSAEIKNDLFSKSTVGLQCLRSDS    351 - 420
KEGPYVSVPLNCSCGDTVQAQLHNLEPCMYVAVVAHGPSILYPSTVWDFINKKVTVGLYGPKHIHPSFKT    421 - 490
VVTIFGHDCAPKTLLVSEVTRQAPNPAPVALQLWGKHQFVLSRPQDLKVCMFSNMTNYEVKASEQAKVVR    491 - 560
GFQLKLGKVSRLIFPITSQNPNELSDFTLRVQVKDDQEAILTQFCVQTPQPPPKSAIKPSGQRRFLKKNE    561 - 630
VGKIILSPFATTTKYPTFQDRPVSSLKFGKLLKTVVRQNKNHYLLEYKKGDGIALLSEERVRLRGQLWTK    631 - 700
EWYIGYYQGRVGLVHTKNVLVVGRARPSLCSGPELSTSVLLEQILRPCKFLTYIYASVRTLLMENISSWR    701 - 770
SFADALGYVNLPLTFFCRAELDSEPERVASVLEKLKEDCNNTENKERKSFQKELVMALLKMDCQGLVVRL    771 - 840
IQDFVLLTTAVEVAQRWRELAEKLAKVSKQQMDAYESPHRDRNGVVDSEAMWKPAYDFLLTWSHQIGDSY    841 - 910
RDVIQELHLGLDKMKNPITKRWKHLTGTLILVNSLDVLRAAAFSPADQDDFVI                     911 - 963
//

Text Mined References (24)

PMID Year Title