Property Summary

NCBI Gene PubMed Count 18
PubMed Score 4.22
PubTator Score 21.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
esophageal adenocarcinoma 1.300 2.7e-02
glioblastoma 1.400 7.1e-07
sonic hedgehog group medulloblastoma 1.900 3.2e-05
atypical teratoid / rhabdoid tumor 1.100 3.8e-02
primitive neuroectodermal tumor 1.800 7.7e-04
primary pancreatic ductal adenocarcinoma -1.058 5.5e-03
lung cancer 2.200 1.5e-05
Breast cancer 2.500 2.8e-02
pediatric high grade glioma 1.400 6.0e-05
pilocytic astrocytoma 1.400 2.2e-05
posterior fossa group A ependymoma 1.100 4.2e-06
non primary Sjogren syndrome sicca 1.300 3.1e-02
ovarian cancer 2.700 1.5e-05
Down syndrome 1.400 8.5e-04

Gene RIF (4)

PMID Text
25496667 Genome-wide shRNA screening identifies SH3BP4, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
22575674 SH3BP4 is a negative regulator of the Rag GTPase complex and amino acid-dependent mTORC1 signaling.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16325581 Results show that TTP (SH3BP4), a SH3-containing protein, specifically regulates the internalization of the transferrin receptor (TfR).

AA Sequence

MAAQRIRAANSNGLPRCKSEGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTN      1 - 70
FTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLNYRNSTLSDSGMIDNLPDSPDEVAKELE     71 - 140
LLGGWTDDKKVPGRMYSNNPFWNGVQTNPFLNGNVPVMPSLDELNPKSTVDLLLFDAGTSSFTESSSATT    141 - 210
NSTGNIFDELPVTNGLHAEPPVRRDNPFFRSKRSYSLSELSVLQAKSDAPTSSSFFTGLKSPAPEQFQSR    211 - 280
EDFRTAWLNHRKLARSCHDLDLLGQSPGWGQTQAVETNIVCKLDSSGGAVQLPDTSISIHVPEGHVAPGE    281 - 350
TQQISMKALLDPPLELNSDRSCSISPVLEVKLSNLEVKTSIILEMKVSAEIKNDLFSKSTVGLQCLRSDS    351 - 420
KEGPYVSVPLNCSCGDTVQAQLHNLEPCMYVAVVAHGPSILYPSTVWDFINKKVTVGLYGPKHIHPSFKT    421 - 490
VVTIFGHDCAPKTLLVSEVTRQAPNPAPVALQLWGKHQFVLSRPQDLKVCMFSNMTNYEVKASEQAKVVR    491 - 560
GFQLKLGKVSRLIFPITSQNPNELSDFTLRVQVKDDQEAILTQFCVQTPQPPPKSAIKPSGQRRFLKKNE    561 - 630
VGKIILSPFATTTKYPTFQDRPVSSLKFGKLLKTVVRQNKNHYLLEYKKGDGIALLSEERVRLRGQLWTK    631 - 700
EWYIGYYQGRVGLVHTKNVLVVGRARPSLCSGPELSTSVLLEQILRPCKFLTYIYASVRTLLMENISSWR    701 - 770
SFADALGYVNLPLTFFCRAELDSEPERVASVLEKLKEDCNNTENKERKSFQKELVMALLKMDCQGLVVRL    771 - 840
IQDFVLLTTAVEVAQRWRELAEKLAKVSKQQMDAYESPHRDRNGVVDSEAMWKPAYDFLLTWSHQIGDSY    841 - 910
RDVIQELHLGLDKMKNPITKRWKHLTGTLILVNSLDVLRAAAFSPADQDDFVI                     911 - 963
//

Text Mined References (24)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22575674 2012 SH3BP4 is a negative regulator of amino acid-Rag GTPase-mTORC1 signaling.
22419666 2012 Genome wide study of maternal and parent-of-origin effects on the etiology of orofacial clefts.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
20936779 2010 A human MAP kinase interactome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18654987 2008 Identification of multi-SH3 domain-containing protein interactome in pancreatic cancer: a yeast two-hybrid approach.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16325581 2005 TTP specifically regulates the internalization of the transferrin receptor.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15616480 2004 Nuclear and plasma membrane localization of SH3BP4 in retinal pigment epithelial cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10644451 1999 Cloning, chromosomal localization, and characterization of cDNA from a novel gene, SH3BP4, expressed by human corneal fibroblasts.
9303539 1997 Binding specificity and in vivo targets of the EH domain, a novel protein-protein interaction module.
7568168 1995 A protein-binding domain, EH, identified in the receptor tyrosine kinase substrate Eps15 and conserved in evolution.