Property Summary

NCBI Gene PubMed Count 85
PubMed Score 340.62
PubTator Score 123.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
diabetes mellitus 1728 0.0 4.0

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer 2.200 2.7e-02
cutaneous lupus erythematosus 1.200 1.0e-02
gastric carcinoma 1.300 1.2e-02
interstitial cystitis 1.400 1.2e-03
intraductal papillary-mucinous adenoma (... -1.600 3.4e-06
intraductal papillary-mucinous carcinoma... -1.600 5.3e-05
juvenile dermatomyositis 1.150 4.5e-10
lung cancer -1.600 2.0e-03
non-small cell lung cancer -1.295 7.7e-16
ovarian cancer 1.400 1.4e-04
primary Sjogren syndrome 1.200 2.4e-03
spina bifida 1.251 4.9e-02

Protein-protein Interaction (1)

Gene RIF (62)

AA Sequence

MNGPALQPSSPSSAPSASPAAAPRGWSEFCELHAVAAARELARQYWLFAREHPQHAPLRAELVSLQFTDL      1 - 70
FQRYFCREVRDGRAPGRDYRDTGRGPPAKAEASPEPGPGPAAPGLPKARSSEELAPPRPPGPCSFQHFRR     71 - 140
SLRHIFRRRSAGELPAAHTAAAPGTPGEAAETPARPGLAKKFLPWSLAREPPPEALKEAVLRYSLADEAS    141 - 210
MDSGARWQRGRLALRRAPGPDGPDRVLELFDPPKSSRPKLQAACSSIQEVRWCTRLEMPDNLYTFVLKVK    211 - 280
DRTDIIFEVGDEQQLNSWMAELSECTGRGLESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASPGGLLDP    281 - 350
ACQKTDHFLSCYPWFHGPISRVKAAQLVQLQGPDAHGVFLVRQSETRRGEYVLTFNFQGIAKHLRLSLTE    351 - 420
RGQCRVQHLHFPSVVDMLHHFQRSPIPLECGAACDVRLSSYVVVVSQPPGSCNTVLFPFSLPHWDSESLP    421 - 490
HWGSELGLPHLSSSGCPRGLSPEGLPGRSSPPEQIFHLVPSPEELANSLQHLEHEPVNRARDSDYEMDSS    491 - 560
SRSHLRAIDNQYTPL                                                           561 - 575
//

Text Mined References (89)

PMID Year Title