Property Summary

NCBI Gene PubMed Count 201
PubMed Score 653.04
PubTator Score 533.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus -1.500 4.8e-03
non-small cell lung cancer -4.202 3.8e-17
intraductal papillary-mucinous carcinoma... -1.100 3.1e-03
lung cancer -8.800 4.5e-08
lung adenocarcinoma -4.100 5.9e-08
posterior fossa group B ependymoma 1.400 2.5e-05
lung carcinoma -2.300 1.7e-24
facioscapulohumeral dystrophy 1.800 1.5e-02

 GO Function (1)

Protein-protein Interaction (4)

Gene RIF (193)

PMID Text
27012038 The SP-D level showed positive correlations with carotid IMT and coronary artery calcification in patients on long-term hemodialysis.
26617840 Serum SP-D may serve as a convenient medium to distinguish lung infection caused by M. pneumoniae.
26603976 Human and murine data together indicate that SP-A, SP-D and MBL are synthesized in early gestational tissues, and may contribute to regulation of immune response at the feto-maternal interface during pregnancy.
26568332 Quantitative real-time PCR experiments disclosed significantly increased leukocyte NOS2 and SFTPD mRNA levels in hyperglycemic gestational diabetes mellitus patients (P < 0.05).
26424433 Serum SP-D was not significantly different between patients with connective tissue disease-interstitial lung disease, chronic fibrosing interstitial pneumonia patients and healthy controls.
26206179 findings shed new light on the discovery and/or development of a useful biomarker based on glycosylation changes for diagnosing COPD.
25851191 In chromium-exposed workers, blood levels of CC16, and CC16/SP-D were lower than in controls. Positive relationships were shown between CC16 or CC16/SP-D and indicators of lung function.
25848896 SP-D is expressed differently in airways of asthmatics relative to that of non-asthmatics.
25728058 Sputum and bronchoalveolar lavage fluid SFTPD were significantly higher in patients with severe asthma compared to mild-moderate asthma and healthy controls.
25591150 Letter: report higher serum SP-D levels in bird-related hypersensitivity pneumonitis during winter.
25537934 Results revealed that higher circulating levels of SP-D are associated with higher mortality risk in critically ill A/H1N1 patients.
25376584 We demonstrated for the first time in a Chinese population cohort that genetic polymorphisms of SP-D are not only associated with risk of COPD development, but also related to disease manifestation and that they predict outcomes.
25362659 In Sjogren's syndrome, high SP-D levels were found in patients with severe glandular involvement, hypergammaglobulinemia, leukopenia, extraglandular manifestations, and positive anti-Ro/La antibodies.
25291941 SP-D levels were significantly higher in the sub-massive pulmonary embolism group overall.
25036364 the multi-faceted role of human SP-D against HIV-1
25036364 SP-D inhibits HIV-1 gp120-CD4 interaction and acts like cell entry inhibitor of HIV-1
25015576 SFTPD polymorphism is associated with the risk of respiratory outcomes; it may be an essential factor affecting pulmonary adaptation in premature infants
24960334 In this review, we highlight the associations of eosinophilic lung diseases with SP-A and SP-D levels and functions.
24880792 In idiopathic pleuroparenchymal fibroelastosis SP-D was elevated, while KL-6 was within a normal range.
24712849 murine expression of human polymorphic variants does not significantly influence the severity of allergic airway inflammation
24705721 Surfactant protein D substitutions at the 325 and 343 positions (D325A+R343V) exhibit markedly increased antiviral activity for seasonal strains of influenza A virus.
24610936 SFTPD single-nucleotide polymorphisms, rs1923536 and rs721917, and haplotypes, including these single-nucleotide polymorphisms or rs2243539, were inversely associated with expiratory lung function in interaction with smoking.
24608429 These data suggest that SP-D reduces EGF binding to EGFR through the interaction between the carbohydrate recognition domain of SP-D and N-glycans of EGFR, and downregulates EGF signaling.
24585933 a novel pathway for the immunomodulatory functions of SP-D mediated via binding of its collagenous domains to LAIR-1.
24504887 Results suggest that Smokers who are carriers of the SFTPD AG and AA polymorphic genotypes may be at a higher risk of developing Chronic obstructive pulmonary disease when compared with wild-type GG genotype carriers.
24400879 serum SP-D, but not SP-A, levels were significantly higher in the German than in the Japanese cohort
24391984 Human surfactant protein D alters oxidative stress and HMGA1 expression to induce p53 apoptotic pathway in eosinophil leukemic cell line.
24264011 Genetic disposition for low surfactant protein-D was not associated with rheumatoid arthritis but with erosive rheumatoid arthritis by interaction with smoking.
24224757 Data suggest that human surfactant protein D not only binds to glycan chains on HA (hemagglutinin, human influenza A virus, strain H3N2) but also blocks the sialic acid receptor binding site upon binding to the glycan chains on HA.
24121782 Both mRNA and protein levels of gp340 were significantly higher in patients with biofilm associated chronic rhinosinusitis (CRS) than those with CRS and no biofilm and controls.
24120837 Lower oligomeric form of surfactant protein D is associated with cystic fibrosis.
24093802 there was no evidence for any association between common polymorphisms in the SP-B and SP-D genes and COPD risk (all p>0.05).
23932215 we identified no novel surfactant protein D gene (SFTPD) coding or splice region variants in 73 unrelated children with diffuse lung disease
23874631 Lung permeability biomakers [surfactant protein D (SP-D) and Clara cell secretory protein (CC16) in plasma] and forced expiratory volumes and flow were measured in swimmers in indoor swimming pool waters treated with different disinfection methods.
23841811 Donor surfactant protein D polymorphisms are associated with chronic lung allograft dysfunction.
23588945 In patients with systemic sclerosis-related interstitial lung disease, surfactant protein D was correlated with forced vital capacity. It was not a longterm prognostic indicator.
23577114 SP-D gene polymorphisms are associated with insulin resistance and T2D
23527085 SP-D inhibits HIV-1 gp120-CD4 interaction and acts like cell entry inhibitor of HIV-1
23435141 SP-D may be important for early detection of interstitial pneumonitis in pegylated interferon treated hepatitis C patients.
23406594 elevated expression in nasal mucosa in chronic rhinosinusitis with polyps
23391661 SP-D modulates the inflammatory response and helps to maintain a balance between effective neutralization/killing of IAV, and protection against alveolar damage resulting from IAV-induced excessive inflammatory responses
23314596 SP-D levels are associated with 1-year prognosis in patients with chronic kidney disease.
23244171 Review discussing associations between COPD and lung specific surfactant protein D (SP-D) single nucleotide polymorphisms, as well as how COPD has been associated with higher levels of serum SP-D.[review]
23144326 A Genome wide association study for COPD biomarkers on subjects with COPD identified single nucleotide polymorphisms with surfactant protein D in expressed sputum.
23052388 Unlike collectins or human neutrophil defensins (HNPs), LL-37 did not induce viral aggregation.
23012359 SP-D can protect the bladder urothelium against UPEC infection and suggest a possible function of SP-D in urinary tract.
22983659 Increases in serum KL-6 and SP-D levels during the first 4 weeks after starting therapy, but not their levels at any one time point, predict poor prognosis in patients with polymyositis/dermatomyositis.
22860023 Cleavage of SP-D by MMP-9 using levels of protein similar to that observed in patients with chronic lung disease suggests in vivo relevance for this cleavage event.
22846212 Polymorphism at rs721917 is associated with reduced serum SP-D levels and risk of Chronic Obstructive Pulmonary Disease.
22511785 Surfactant protein D (Sp-D) binds to membrane-proximal domain (D3) of signal regulatory protein alpha (SIRPalpha), a site distant from binding domain of CD47, while also binding to analogous region on signal regulatory protein beta (SIRPbeta).
22509983 The SFTPD single nucleotide polymorphism, rs721917, was associated with emphysema, interstitial pneumonia, and lung cancer. Haplotypes associated with emphysema and lung cancer differed from that associated with interstitial pneumonia.
22289856 Results suggest that the fetal surfactant protein D Met31Thr polymorphism plays a significant role in genetic predisposition to spontaneous preterm birth.
22288595 over-expression of SP-D reduced significantly the LPS-induced expression of MCP-1 in transfected renal tubular epithelial cells
21960125 SFTPD polymorphism provide evidence in the development of bronhopulmonary dysplasia and respiratory distress syndrome in premature infants.
21934714 This suggests a protective effect of SFTPD against COPD and emphysema.
21858107 Data sshow that variants in SFTPD, CD46 and IL1R1 are associated with IPD in both EA and AA.
21828236 High serum surfactant protein-D is associated with lung cancer.
21821801 surfactant protein A and surfactant protein D play critical roles in host defense against Mycobacterium avium.
21790524 genetic association of 2 nonsynonymous SP-D SNPs rs721917 and rs2243639 in inflammatory bowel disease (IBD) cases and controls; results suggest differential allelic expression may affect penetrance of the SNP rs721917 disease-susceptibility allele in IBD
21678446 Reduction of surfactant protein D in H5N1 influenza may play important roles in the pathogenesis of the disease.
21601013 there is an association of risk for severe acute respiratory syncytial infection in individuals who present the allele Thr160 in surfactant protein D
21560203 SNPs unrelated to susceptibility to inflammatory bowel disease in German population
21489996 Introduction of N-linked glycans in the lectin domain of surfactant protein D: impact on interactions with influenza A viruses.
21396106 Pulmonary and serum SP-D levels are stable markers influenced by smoking and related to airflow obstruction and disease state in chronic pulmonary obstructive disease.
21310059 Our study indicates that missense single nucleotide polymorphisms and haplotypes of SFTPA1, SFTPA2 and SFTPD are associated with susceptibility to community-acquired pneumonia(CAP), and that several haplotypes also influence severity and outcome of CAP.
21233593 The levels of intracellular reactive oxygen species and lipid peroxidation in A549 cells increased with increasing exposure to NiO nanoparticles, and increases in gene expressions of HO-1 and SP-D were observed
21204009 surfactant protein D interacts with myeloperoxidase on the surface of late apoptotic neutrophils
21171185 Mean serum SP-D concentrations in patients with RSV bronchiolitis were higher than those in the control group. Mean serum SP-D concentrations were higher in the in Stage C than in Stages A or B patients, and higher in Stage B than in Stage A patients.
20799037 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20683434 Letter: serum SP-D cannot be used as a biomarker predictive for bronchiolitis obliterans after lung transplantation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20601494 An extended binding site for influenza A virus; calcium-dependent antiviral activity involves residues flanking the primary carbohydrate binding site as well as more remote residues displayed on the carbohydrate recognition domain surface.
20560296 Surfactant protein-D showed to be a significant predictor of prognosis, even when corrected for age, sex, smoking, and lung function.
20512337 Pulmonary surfactant protein D exhibited diurnal variation in healthy controls and in patients with early or late rheumatoid arthritis, with peak values at 10 AM and nadir in the evening.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20457545 Serum SP-D (Surfactant protein D) in Cystic Fibrosis patients was increased in parallel with leukocyte count and with reduced FEV-1 (forced expiratory volume 1)
20457545 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20448057 Polymorphisms in surfactant protein-D are associated with chronic obstructive pulmonary disease
20448057 Observational study of gene-disease association. (HuGE Navigator)
20360592 Circulating surfactant protein D concentrations are higher in intrauterine growth-restricted fetuses than in pulmonary diseases inappropriate for gestational age and intrauterine growth-restricted pregnancies.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20228064 analysis of myeloperoxidase-dependent inactivation of surfactant protein D in vitro and in vivo
20211020 Observational study of gene-disease association. (HuGE Navigator)
20207732 SP-D utilizes a novel mechanism in which the collectin interacts with protease inhibitor A2M to decrease its degradation and to concurrently increase its innate immune function.
20205699 inhibition of Der p-induced activation of macrophages and monocyte-derived dendritic cells by SP-D is mediated through suppression of the CD14/TLR signalling pathway and maintenance of DC-SIGN expression.
20086254 Findings suggest that lung innate immunity, as inferred from circulating SP-D concentrations, is at the cross-roads of inflammation, obesity, and insulin resistance.
20075511 serum SP-D levels are increased in patients during chronic obstructive pulmonary disease (COPD) exacerbations and may be a potential diagnostic biomarker for COPD exacerbations.
20056602 SP-A and SP-D bound to L. pneumophila and its lipopolysaccharide (LPS) and inhibited the bacterial growth in a Ca(2+)-dependent manner
19913121 Observational study of gene-disease association. (HuGE Navigator)
19833760 These findings suggest that low surfactant protein-D, unrelated to conventional disease indicators, represents an aspect of systemic lupus erythematosus etiopathogenesis.
19799916 Asp325, in addition to Arg343, is an important determinant of ligand selectivity, recognition, and binding.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19684355 The 343 position is critical in defining the binding pattern of SP-D proteins to Mycobacterium tuberculosis and its mannosylated cell envelope components.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19590686 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19577304 purified trimeric and multimeric SP-D represent separate and only partly interconvertible molecular populations with distinct biochemical properties.
19540617 the time-dependent variation in serum SP-D throughout a period of 6 months was characterized.
19493231 the Met11Thr polymorphism in SFTPD plays a major role in the genetic predisposition to allergic rhinitis in Chinese adult population, whereas the other two SFTPD polymorphisms displayed no significant association with allergic rhinitis.
19493231 Observational study of gene-disease association. (HuGE Navigator)
19478465 Serum KL-6 and SP-D appear to be elevated in a mutually exclusive manner in adult T-cell leukemia.
19439011 monitoring systemic SP-D may be useful in monitoring the alveolar integrity in SARS-type pneumonia.
19378784 plays a role in innate immunity. (review(
19348329 Observational study of gene-disease association. (HuGE Navigator)
19340882 SFTPD is both a susceptibility gene and a disease-modifying gene for ulcerative colitis in Japanese
19340882 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19287351 There may be associations between SP-A and SP-D and respiratory syncytial virus disease.
19287351 Observational study of gene-disease association. (HuGE Navigator)
19286849 Serum levels of SP-D and KL-6 appear to be indicative of "alveolitis" in systemic sclerosis patients, and are significantly higher than in SSc patients without "alveolitis."
19275746 The coiled-coil neck domain of SP-D enables the trimerization and stabilization of the heterologous non-collagenous thioredoxin.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19249874 An extended ligand binding site is shown for mannosylated ligands on SFTPD and a significant contribution of residue 343 side chain to specific recognition of multivalent microbial ligands, including high-mannose glycans of influenza A virus.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19164344 serum surfactant protein D is steroid sensitive and associated with exacerbations of COPD
19140875 SFTPD polymorphisms were associated with the presence of coronary stenosis.
19140875 Observational study of gene-disease association. (HuGE Navigator)
19017984 Multimerization of surfactant protein D, but not its collagen domain, is required for antiviral and opsonic activities related to influenza virus.
18991397 SP-D directly interacts with MD-2 through the CRD.
18990700 SP-D down-regulates LPS-elicited inflammatory responses by altering LPS binding to its receptors and reveals the importance of the correct oligomeric structure of the protein in this process.
18983439 The researchers investigated the relationship between genetic variants of the surfactant protein D gene and the development of SIDS and found no evidence of an association.
18983439 Observational study of gene-disease association. (HuGE Navigator)
18811961 Inhibition by SP-D correlates with presence of several glycan attachment sites on the HA.
18785967 The researchers found an association between the surfactant protein D SNP rs1923537 variation and the development of respiratory distress syndrome.
18785967 Observational study of gene-disease association. (HuGE Navigator)
18779194 Reduced SP-D expression in BAL fluid was associated with the progression of bronchial dysplasia. SP-D levels in BAL fluid may serve as a potential biomarker to identify smokers who are at risk of early lung cancer.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18657106 results showed that corneal epithelial cells produced and secreted SP-D constitutively in culture, and that production and secretion of SP-D were upregulated after exposure to heat-killed P. aeruginosa or to purified flagellin or lipopolysaccharide
18498293 Blood level can be used as a marker for chronic periodontitis. Three polymorphisms(Met11Thr, Ala160Thr and Ser270Thr) are not associated either with level or with periodontitis.
18498293 Observational study of gene-disease association. (HuGE Navigator)
18359891 SP-D is expressed in human coronary arteries and functions as an anti-inflammatory protein in the smooth muscle cells. SP-D may also participate in the host defense against pathogens that invade the vascular wall.
18355911 Surfactant protein (SP) D-dependent innate immunity influences atopy and asthma.
18347569 allogeneic hematopoietic stem-cell transplantation patients with lower pretransplant serum surfactant protein D (SP-D) level had a trend toward frequent development of Bronchiolitis obliterans syndrome and idiopathic pneumonia syndrome
18302538 These results show that antiviral activities of surfactant protein-D can be reproduced without the N-terminal and collagen domains and that cross-linking of these domains is essential for anti-influenza A virus activity.
18266831 A SP-D-deficient patients had more frequently pneumonias and their long-term outcome was worse than that of the children with detectable SP-D.
18251786 In lung of patients with pulmonary alveolar proteinosis, SP-D was localized eoosinophilic large globules surrounded by an SP-A positive fine granular substance.
18226251 Further, we speculate that inhaled steroids may induce SP-D expression and that this mechanism may contribute to their beneficial effects in COPD.
18211966 Pre-eminent role for neutrophil elastase as the critical protease responsible for PSP-D depletion in inflammatory lung disease.
18191856 Report presence and subcellular localizations of surfactant proteins A and D in human spermatozoa.
18092821 Interactions with the side chain of inner core heptoses provide a potential mechanism for the recognition of diverse types of lipopolysaccharides by SP-D.
18052966 Low serum level of SP-D and lack of correlation with traditional rheumatoid arthritis (RA) activity measures indicate that SP-D reflects a distinctive aspect in RA pathogenesis.
17999785 SP D and TNF-alpha are significantly increased in CF compared with AFRS, suggesting activation of both innate immunity and Th1-mediated inflammation and potential correlation between SPs and downstream adaptive immune responses
17874049 Both SP-A and KL-6 were detected in intimate relationship to the stage of regeneration of alveolar epithelial cells and were expressed before SP-D.
17848554 the degradation and consequent inactivation of SP-A and SP-D may be a novel mechanism to account for the potent allergenicity of these common dust mite allergens.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17693780 Serum surfactant-protein D (SP-D) concentrations increased in silica-exposed miners and may associate with pathogenesis of and be a useful biomarker for early diagnosis of silicosis.
17567900 Surfactant protein D levels are increased in lung fluid from AIDS patients but not in patients with early HIV infection.
17524024 Observational study of gene-disease association. (HuGE Navigator)
17524024 A two-marker haplotype of SP-A and SP-D associates with protection from respiratory distress syndrome in premature infants; also, three- and four-marker haplotypes containing one or both markers associate with protection against RDS.
17264398 Observational study of gene-disease association. (HuGE Navigator)
17209137 SP-A, SP-B, and SP-D are expressed in human nasal mucosa and cultured normal human nasal epithelial cells.
17083016 Observational study of gene-disease association. (HuGE Navigator)
16889547 broncho-alveolar lavage fluid with high levels of bile acids also had significantly lower SP-A, SP-D, dipalmitoylphosphatidylcholine
16834340 Human SP-D binds the extracellular domains of TLR2 and TLR4 through its carbohydrate recognition domain by a mechanism different from its binding to phosphatidylinositol and lipopolysaccharide.
16709857 In vitro interactions during the early phase of host defense against influenza A virus suggest a complex interplay between SP-D and human neutrophil defensins at sites of active inflammation.
16636058 Phe-335, which is evolutionarily conserved in all known SP-Ds, plays important, if not critical, roles in SP-D function
16514117 The ligand binding of homologous human, rat, and mouse trimeric trimeric neck plus carbohydrate recognition domain (neck+CRD) fusion proteins, each with identical N-terminal tags remote from the ligand-binding surface, was compared.
16426259 Observational study of gene-disease association. (HuGE Navigator)
16426259 functional amino acid variants in SFTPD do not play a major role in the genetic pre-disposition to bronchial asthma in children.
16406431 Decreased levels of SP-A and SP-D have been measured in bronchoalveolar lavage fluid of these patients, as well as patients with acute pneumonia but no chronic lung disease. (review)
16385451 Observational study of gene-disease association. (HuGE Navigator)
16361352 Serum SP-D concentrations in children are genetically determined and that a single nucleotide polymorphism (SNP) located in the NH(2)-terminal region (Met11Thr) of the mature protein is associated with serum SP-D levels.
16227233 SP-D inhibits HIV-1 gp120-CD4 interaction and acts like cell entry inhibitor of HIV-1
16114131 role in Aspergillus mediated allergies and infections
16061223 SP-D binds various classes of immunoglobins, including IgG, IgM, IgE and secretory IgA, but not serum IgA.
15951332 The ability of SP-D to increase neutrophil uptake of influenza A virus can be dissociated from enhancement of oxidant responses
15711012 analysis of ligand specificity of human surfactant protein D
15700120 Observational study of gene-disease association. (HuGE Navigator)
15700120 Identification of specific haplotype of SPTPD gene that indicates its negative association with SP-D levels in the serum.
15661913 Polymorphic variation in the N-terminal domain of the SP-D molecule influences oligomerization, function, and the concentration of the molecule in serum.
15608147 SP-D, SP-A, and gp340 showed cooperative antiviral interactions
15274124 Data describe a proteome analysis of surfactant proteins SP-A and SP-D in bronchoalveolar lavage fluid from patients with cystic fibrosis, chronic bronchitis and pulmonary alveolar proteinosis.
15244040 serum SP-D levels may serve as a good diagnostic indicator of acute respiratory distress syndrome in patients with sepsis
15173172 surfactant protein D gene transcription is regulated by NFAT and thyroid transcription factor-1
15145932 surfactant proteins A and D and mannose-binding lectin play roles in inflammation caused by DNA in lungs and other tissues
15123664 Degradation of pulmonary surfactant protein D by Pseudomonas aeruginosa elastase abrogates innate immune function
15102713 Observational study of gene-disease association. (HuGE Navigator)
15067073 A recombinant trimeric fragment of surfactant protein D chemically cross-linked to the Fab' of anti-Fc alpha receptor monoclonal antibody markedly enhances the uptake of influenza A virus, Candida albicans, and Escherichia coli by neutrophils in vitro.
13680361 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12888356 SP-D has roles in ligand binding and immune cell recognition because of its multivalent ligand binding and recognition sites
12853121 Limited proteolysis of SFTPD causes a loss of its calcium-dependent lectin functions.
12730206 carbohydrate recognition domains of SP-D interact with the dermatan sulfate moiety of decorin via lectin activity and the core protein of decorin binds the collagen-like region of SP-D
12654779 aggregation of Pneumocystis carinii by SP-D was shown to be responsible for the impaired phagocytosis of the organisms by alveolar macrophages
12654643 Pseudomonas aeruginosa elastase degrades this protein in human lung.
12479105 SP-D mRNA might be a valuable marker to detect circulating tumor cells in the peripheral blood of lung cancer patients.
12244199 SP-D enhances phagocytosis of apoptotic cells by human and murine alveolar macrophages in vitro, independent of the apoptotic cell type.
12218146 SP-D preferentially inhibits the adhesion of the O3-serotype of Klebsiella pneumoniae to lung epithelial cells.
12218102 Intrapulmonary administration of a truncated 60-kDa fragment of human recombinant SP-D into SP-D-deficient mice reduces the number of apoptotic and necrotic alveolar macrophages and partially corrects the lipid accumulation.
12032263 Observational study of gene-disease association. (HuGE Navigator)
12032263 Surfactant protein D gene polymorphism associated with severe respiratory syncytial virus infection.
11916969 binds Mycoplasma pneumoniae by high affinity interactions with lipids
11912209 Surfactant protein D gene regulation. Interactions among the conserved CCAAT/enhancer-binding protein elements
11854236 SP-D (surfactant protein D) may therefore play a significant role in the innate immune response to H. pylori infection

AA Sequence

MLLFLLSALVLLTQPLGYLEAEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPG      1 - 70
AAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGE     71 - 140
AGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIP    141 - 210
GDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLL    211 - 280
CTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSED    281 - 350
CVEIFTNGKWNDRACGEKRLVVCEF                                                 351 - 375
//

Text Mined References (203)

PMID Year Title
27012038 2016 Serum Surfactant Protein D is Associated with Atherosclerosis of the Carotid Artery in Patients on Maintenance Hemodialysis.
26617840 2015 SP-D, KL-6, and HTI-56 levels in children with mycoplasma pneumoniae pneumonia.
26603976 2016 Expression and localization of collectins in feto-maternal tissues of human first trimester spontaneous abortion and abortion prone mouse model.
26568332 2016 Increased expression of immune-related genes in leukocytes of patients with diagnosed gestational diabetes mellitus (GDM).
26424433 2015 Serum B cell-activating factor (BAFF) level in connective tissue disease associated interstitial lung disease.
26206179 2015 Fucosylated surfactant protein-D is a biomarker candidate for the development of chronic obstructive pulmonary disease.
25851191 2015 Biomarkers for lung epithelium injury in occupational hexavalent chromium-exposed workers.
25848896 2015 Expression of surfactant protein D in airways of asthmatics and interleukin-13 modulation of surfactant protein D in human models of airway epithelium.
25728058 2015 Sputum and BAL Clara cell secretory protein and surfactant protein D levels in asthma.
25591150 2015 Seasonal variation of serum KL-6 and SP-D levels in bird-related hypersensitivity pneumonitis.
25537934 2015 Serum surfactant protein D (SP-D) is a prognostic marker of poor outcome in patients with A/H1N1 virus infection.
25376584 2015 Genetic variants of pulmonary SP-D predict disease outcome of COPD in a Chinese population.
25362659 2015 Etiopathogenic role of surfactant protein d in the clinical and immunological expression of primary Sjögren syndrome.
25291941 2014 The effectiveness of the serum surfactant protein D (Sp-D) level to indicate lung injury in pulmonary embolism.
25036364 2014 Surfactant protein D inhibits HIV-1 infection of target cells via interference with gp120-CD4 interaction and modulates pro-inflammatory cytokine production.
25015576 2014 Surfactant protein-D-encoding gene variant polymorphisms are linked to respiratory outcome in premature infants.
24960334 2014 Eosinophil-associated lung diseases. A cry for surfactant proteins A and D help?
24880792 2014 Idiopathic pleuroparenchymal fibroelastosis is characterized by an elevated serum level of surfactant protein-D, but Not Krebs von den Lungen-6.
24712849 2014 Impact of a Met(11)Thr single nucleotide polymorphism of surfactant protein D on allergic airway inflammation in a murine asthma model.
24705721 2014 Mutations flanking the carbohydrate binding site of surfactant protein D confer antiviral activity for pandemic influenza A viruses.
24610936 2014 Surfactant protein D is a candidate biomarker for subclinical tobacco smoke-induced lung damage.
24608429 2015 Surfactant protein D suppresses lung cancer progression by downregulation of epidermal growth factor signaling.
24585933 2014 Leukocyte-associated Ig-like receptor-1 is a novel inhibitory receptor for surfactant protein D.
24504887 2014 Genetic polymorphisms of surfactant protein D rs2243639, Interleukin (IL)-1? rs16944 and IL-1RN rs2234663 in chronic obstructive pulmonary disease, healthy smokers, and non-smokers.
24400879 2014 Differences in serum SP-D levels between German and Japanese subjects are associated with SFTPD gene polymorphisms.
24391984 2013 Human surfactant protein D alters oxidative stress and HMGA1 expression to induce p53 apoptotic pathway in eosinophil leukemic cell line.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24264011 2014 Smoking and polymorphisms of genes encoding mannose-binding lectin and surfactant protein-D in patients with rheumatoid arthritis.
24224757 2013 Molecular mechanisms of inhibition of influenza by surfactant protein D revealed by large-scale molecular dynamics simulation.
24121782 2014 Enhanced expressions of lysozyme, SLPI and glycoprotein 340 in biofilm-associated chronic rhinosinusitis.
24120837 2013 Functional heterogeneity of pulmonary surfactant protein-D in cystic fibrosis.
24093802 2013 Functional polymorphisms in surfactant protein genes and chronic obstructive pulmonary disease risk: a meta-analysis.
23932215 2013 Candidate gene analysis of the surfactant protein D gene in pediatric diffuse lung disease.
23874631 2013 Respiratory function and changes in lung epithelium biomarkers after a short-training intervention in chlorinated vs. ozone indoor pools.
23841811 2013 Donor surfactant protein D (SP-D) polymorphisms are associated with lung transplant outcome.
23588945 2013 Can serum surfactant protein D or CC-chemokine ligand 18 predict outcome of interstitial lung disease in patients with early systemic sclerosis?
23577114 2013 Common genetic variants of surfactant protein-D (SP-D) are associated with type 2 diabetes.
23478426 2013 The lung innate immune gene surfactant protein-D is expressed in adipose tissue and linked to obesity status.
23435141 2012 Surfactant protein-D is more useful than Krebs von den Lungen 6 as a marker for the early diagnosis of interstitial pneumonitis during pegylated interferon treatment for chronic hepatitis C.
23406594 2013 Detection of surfactant proteins A, B, C, and D in human nasal mucosa and their regulation in chronic rhinosinusitis with polyps.
23391661 2013 Pulmonary surfactant protein D in first-line innate defence against influenza A virus infections.
23314596 2013 Serum surfactant protein D is associated with the prognosis in patients with chronic kidney disease.
23244171 2012 Surfactant protein D as a biomarker for chronic obstructive pulmonary disease.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
23052388 2013 The human cathelicidin LL-37 inhibits influenza A viruses through a mechanism distinct from that of surfactant protein D or defensins.
23012359 2012 Surfactant protein D inhibits adherence of uropathogenic Escherichia coli to the bladder epithelial cells and the bacterium-induced cytotoxicity: a possible function in urinary tract.
22983659 2013 Marked increase in serum KL-6 and surfactant protein D levels during the first 4 weeks after treatment predicts poor prognosis in patients with active interstitial pneumonia associated with polymyositis/dermatomyositis.
22860023 2012 MMP-9 cleaves SP-D and abrogates its innate immune functions in vitro.
22846212 2012 SP-D polymorphisms and the risk of COPD.
22511785 2012 Surfactant protein D (Sp-D) binds to membrane-proximal domain (D3) of signal regulatory protein ? (SIRP?), a site distant from binding domain of CD47, while also binding to analogous region on signal regulatory protein ? (SIRP?).
22509983 2012 Association between genetic variations in surfactant protein d and emphysema, interstitial pneumonia, and lung cancer in a Japanese population.
22289856 2012 A study of collectin genes in spontaneous preterm birth reveals an association with a common surfactant protein D gene polymorphism.
22288595 2012 Surfactant protein D inhibits lipopolysaccharide-induced monocyte chemoattractant protein-1 expression in human renal tubular epithelial cells: implication for tubulointerstitial fibrosis.
21960125 2012 Genetic associations of surfactant protein D and angiotensin-converting enzyme with lung disease in preterm neonates.
21934714 2012 Involvement of surfactant protein D in emphysema revealed by genetic association study.
21858107 2011 Identifying host genetic risk factors in the context of public health surveillance for invasive pneumococcal disease.
21828236 2011 Circulating markers of interstitial lung disease and subsequent risk of lung cancer.
21821801 2011 Pulmonary collectins play distinct roles in host defense against Mycobacterium avium.
21790524 2011 Genetic variants and monoallelic expression of surfactant protein-D in inflammatory bowel disease.
21678446 2011 Decreased expression of surfactant protein D mRNA in human lungs in fatal cases of H5N1 avian influenza.
21601013 2011 SP-A1, SP-A2 and SP-D gene polymorphisms in severe acute respiratory syncytial infection in Chilean infants.
21560203 2011 Functional SFTPD gene variants are not associated with susceptibility to inflammatory bowel disease in the German population.
21489996 2011 Introduction of N-linked glycans in the lectin domain of surfactant protein D: impact on interactions with influenza A viruses.
21396106 2011 Comprehensive characterisation of pulmonary and serum surfactant protein D in COPD.
21310059 2011 Influence of genetic variability at the surfactant proteins A and D in community-acquired pneumonia: a prospective, observational, genetic study.
21233593 2011 Evaluation of acute oxidative stress induced by NiO nanoparticles in vivo and in vitro.
21204009 2010 Surface-bound myeloperoxidase is a ligand for recognition of late apoptotic neutrophils by human lung surfactant proteins A and D.
21171185 2011 Serum SP-D levels as a biomarker of lung injury in respiratory syncytial virus bronchiolitis.
20799037 2011 Gene-gene interaction between tuberculosis candidate genes in a South African population.
20683434 2010 Clara cell secretory protein and surfactant protein-D do not predict bronchiolitis obliterans syndrome after lung transplantation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20601494 2010 Monoclonal antibody-assisted structure-function analysis of the carbohydrate recognition domain of surfactant protein D.
20560296 2009 Surfactant protein-D predicts survival in patients with idiopathic pulmonary fibrosis.
20512337 2011 Circadian rhythm and the influence of physical activity on circulating surfactant protein D in early and long-standing rheumatoid arthritis.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20457545 2010 Serum-surfactant SP-D correlates inversely to lung function in cystic fibrosis.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20448057 2011 Polymorphisms in surfactant protein-D are associated with chronic obstructive pulmonary disease.
20360592 2010 The effect of intrauterine growth restriction on circulating surfactant protein D concentrations in the perinatal period.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20228064 2010 Myeloperoxidase-dependent inactivation of surfactant protein D in vitro and in vivo.
20211020 2010 Circulating surfactant protein -D is low and correlates negatively with systemic inflammation in early, untreated rheumatoid arthritis.
20207732 2010 Surfactant protein D interacts with alpha2-macroglobulin and increases its innate immune potential.
20205699 2010 Surfactant protein D inhibits mite-induced alveolar macrophage and dendritic cell activations through TLR signalling and DC-SIGN expression.
20086254 2010 Surfactant protein d, a marker of lung innate immunity, is positively associated with insulin sensitivity.
20075511 2009 Serum surfactant protein D during acute exacerbations of chronic obstructive pulmonary disease.
20056602 2010 Pulmonary collectins protect macrophages against pore-forming activity of Legionella pneumophila and suppress its intracellular growth.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19833760 2009 Circulating surfactant protein D is decreased in systemic lupus erythematosus.
19799916 2009 Structural characterisation of ligand-binding determinants in human lung surfactant protein D: influence of Asp325.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19684355 2009 Critical role of amino acid position 343 of surfactant protein-D in the selective binding of glycolipids from Mycobacterium tuberculosis.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19590686 2009 Postural changes in blood pressure associated with interactions between candidate genes for chronic respiratory diseases and exposure to particulate matter.
19577304 2009 Multimeric and trimeric subunit SP-D are interconvertible structures with distinct ligand interaction.
19540617 2010 Long-term stability and circadian variation in circulating levels of surfactant protein D.
19493231 2009 Association between single nucleotide polymorphisms of surfactant protein D and allergic rhinitis in Chinese patients.
19478465 2009 Elevation of serum KL-6 glycoprotein or surfactant protein-D in adult T-cell leukemia with distinct pulmonary complications.
19439011 2009 Elevated plasma surfactant protein D (SP-D) levels and a direct correlation with anti-severe acute respiratory syndrome coronavirus-specific IgG antibody in SARS patients.
19378784 2009 [Innate immune functions of pulmonary collectins].
19348329 [Genetic markers of predisposition to infectious complications in neonatal infants with respiratory distress syndrome].
19340882 2009 Genetic variants in surfactant, pulmonary-associated protein D (SFTPD) and Japanese susceptibility to ulcerative colitis.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19287351 2009 Transmission of surfactant protein variants and haplotypes in children hospitalized with respiratory syncytial virus.
19286849 2009 Surfactant protein D and KL-6 as serum biomarkers of interstitial lung disease in patients with scleroderma.
19275746 2009 The coiled-coil neck domain of human pulmonary surfactant protein D drives trimerization and stabilization of thioredoxin, a heterologous non-collagenous protein.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19249874 2009 Recognition of mannosylated ligands and influenza A virus by human surfactant protein D: contributions of an extended site and residue 343.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19164344 2009 Serum surfactant protein D is steroid sensitive and associated with exacerbations of COPD.
19140875 2009 The additive contribution from inflammatory genetic markers on the severity of cardiovascular disease.
19100526 2009 Genetic defects in surfactant protein A2 are associated with pulmonary fibrosis and lung cancer.
19017984 2008 Multimerization of surfactant protein D, but not its collagen domain, is required for antiviral and opsonic activities related to influenza virus.
18991397 2008 Pulmonary surfactant protein D binds MD-2 through the carbohydrate recognition domain.
18990700 2008 Pulmonary surfactant protein D inhibits lipopolysaccharide (LPS)-induced inflammatory cell responses by altering LPS binding to its receptors.
18983439 2009 Surfactant protein A and D gene polymorphisms and protein expression in victims of sudden infant death.
18811961 2008 Role of viral hemagglutinin glycosylation in anti-influenza activities of recombinant surfactant protein D.
18785967 2009 Association of polymorphisms in the human surfactant protein-D (SFTPD) gene and postnatal pulmonary adaptation in the preterm infant.
18779194 2008 Surfactant protein D and bronchial dysplasia in smokers at high risk of lung cancer.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18657106 2008 Expression of surfactant protein D in human corneal epithelial cells is upregulated by Pseudomonas aeruginosa.
18498293 2008 Increased plasma concentration of surfactant protein D in chronic periodontitis independent of SFTPD genotype: potential role as a biomarker.
18359891 2008 Surfactant protein D is expressed and modulates inflammatory responses in human coronary artery smooth muscle cells.
18355911 2008 Surfactant protein D alters allergic lung responses in mice and human subjects.
18347569 2008 Prognostic value of serum surfactant protein D level prior to transplant for the development of bronchiolitis obliterans syndrome and idiopathic pneumonia syndrome following allogeneic hematopoietic stem cell transplantation.
18302538 2008 Critical role for cross-linking of trimeric lectin domains of surfactant protein D in antiviral activity against influenza A virus.
18266831 2008 Children with absent surfactant protein D in bronchoalveolar lavage have more frequently pneumonia.
18251786 2008 Differences in the immunolocalization of surfactant protein (SP)-A, SP-D, and KL-6 in pulmonary alveolar proteinosis.
18226251 2008 Chronic obstructive pulmonary disease and inhaled steroids alter surfactant protein D (SP-D) levels: a cross-sectional study.
18211966 2008 Patterns of neutrophil serine protease-dependent cleavage of surfactant protein D in inflammatory lung disease.
18191856 2008 Presence and subcellular localizations of surfactant proteins A and D in human spermatozoa.
18092821 2008 Recognition of heptoses and the inner core of bacterial lipopolysaccharides by surfactant protein d.
18052966 2008 Circulating surfactant protein D is decreased in early rheumatoid arthritis: a 1-year prospective study.
17999785 Innate and adaptive mediators in cystic fibrosis and allergic fungal rhinosinusitis.
17874049 2007 Immunohistochemical distribution of SP-D, compared with that of SP-A and KL-6, in interstitial pneumonias.
17848554 2007 Major house dust mite allergens Dermatophagoides pteronyssinus 1 and Dermatophagoides farinae 1 degrade and inactivate lung surfactant proteins A and D.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17693780 2007 Roles of serum clara cell protein 16 and surfactant protein-D in the early diagnosis and progression of silicosis.
17567900 2007 AIDS patients have increased surfactant protein D but normal mannose binding lectin levels in lung fluid.
17524024 2007 Haplotypes of the surfactant protein genes A and D as susceptibility factors for the development of respiratory distress syndrome.
17264398 2006 Genetic variants of surfactant proteins A, B, C, and D in bronchopulmonary dysplasia.
17209137 2007 Expression and localization of surfactant proteins in human nasal epithelium.
17083016 2006 Genetic polymorphism of the binding domain of surfactant protein-A2 increases susceptibility to meningococcal disease.
16889547 2006 The effect of reflux and bile acid aspiration on the lung allograft and its surfactant and innate immunity molecules SP-A and SP-D.
16834340 2006 Human pulmonary surfactant protein D binds the extracellular domains of Toll-like receptors 2 and 4 through the carbohydrate recognition domain by a mechanism different from its binding to phosphatidylinositol and lipopolysaccharide.
16709857 2006 Innate defense against influenza A virus: activity of human neutrophil defensins and interactions of defensins with surfactant protein D.
16636058 2006 Contributions of phenylalanine 335 to ligand recognition by human surfactant protein D: ring interactions with SP-D ligands.
16514117 2006 Species differences in the carbohydrate binding preferences of surfactant protein D.
16426259 2006 Amino acid variants in Surfactant protein D are not associated with bronchial asthma.
16406431 2006 [Pseudomonas aeruginosa and Surfactant-associated Proteins A and D].
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16361352 2006 Genetic and environmental influences of surfactant protein D serum levels.
16114131 2005 Role of collectins in innate immunity against aspergillosis.
16061223 2005 Collectin surfactant protein D binds antibodies and interlinks innate and adaptive immune systems.
15951332 2005 Respiratory innate immune proteins differentially modulate the neutrophil respiratory burst response to influenza A virus.
15711012 2005 Ligand specificity of human surfactant protein D: expression of a mutant trimeric collectin that shows enhanced interactions with influenza A virus.
15700120 2005 Polymorphisms in the human surfactant protein-D (SFTPD) gene: strong evidence that serum levels of surfactant protein-D (SP-D) are genetically influenced.
15661913 2005 A common polymorphism in the SFTPD gene influences assembly, function, and concentration of surfactant protein D.
15608147 2005 Cooperative anti-influenza activities of respiratory innate immune proteins and neuraminidase inhibitor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15274124 2004 High resolution mass spectrometric alveolar proteomics: identification of surfactant protein SP-A and SP-D modifications in proteinosis and cystic fibrosis patients.
15244040 2002 Surfactant protein A and D (SP-A, AP-D) levels in patients with septic ARDS.
15173172 2004 Nuclear factor of activated T cells regulates transcription of the surfactant protein D gene (Sftpd) via direct interaction with thyroid transcription factor-1 in lung epithelial cells.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15145932 2004 Nucleic acid is a novel ligand for innate, immune pattern recognition collectins surfactant proteins A and D and mannose-binding lectin.
15123664 2004 Degradation of pulmonary surfactant protein D by Pseudomonas aeruginosa elastase abrogates innate immune function.
15102713 2004 Data mining and multiparameter analysis of lung surfactant protein genes in bronchopulmonary dysplasia.
15067073 2004 Effective targeting of pathogens to neutrophils via chimeric surfactant protein D/anti-CD89 protein.
13680361 2003 Surfactant protein A and B genetic variants predispose to idiopathic pulmonary fibrosis.
12888356 2003 High-resolution structural insights into ligand binding and immune cell recognition by human lung surfactant protein D.
12884308 2003 CRP-ductin, the mouse homologue of gp-340/deleted in malignant brain tumors 1 (DMBT1), binds gram-positive and gram-negative bacteria and interacts with lung surfactant protein D.
12853121 2003 Limited proteolysis of surfactant protein D causes a loss of its calcium-dependent lectin functions.
12753670 2003 A single round PCR method for genotyping human surfactant protein (SP)-A1, SP-A2 and SP-D gene alleles.
12730206 2003 Identification and characterization of a novel interaction between pulmonary surfactant protein D and decorin.
12654779 2003 Surfactant protein D-mediated aggregation of Pneumocystis carinii impairs phagocytosis by alveolar macrophages.
12654643 2003 Pseudomonas aeruginosa elastase degrades surfactant proteins A and D.
12479105 2002 [Expression and clinical significance of surfactant protein D mRNA in peripheral blood of lung cancer patients].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12244199 2002 Role of surfactant proteins A, D, and C1q in the clearance of apoptotic cells in vivo and in vitro: calreticulin and CD91 as a common collectin receptor complex.
12218146 2002 Surfactant protein D binds selectively to Klebsiella pneumoniae lipopolysaccharides containing mannose-rich O-antigens.
12218102 2002 Surfactant protein D reduces alveolar macrophage apoptosis in vivo.
12032263 2002 Surfactant protein D gene polymorphism associated with severe respiratory syncytial virus infection.
11967276 2002 Immunolocalization of surfactant protein-D (SP-D) in human fetal, newborn, and adult tissues.
11912209 2002 Surfactant protein D gene regulation. Interactions among the conserved CCAAT/enhancer-binding protein elements.
11278637 2001 Activity of pulmonary surfactant protein-D (SP-D) in vivo is dependent on oligomeric structure.
10820266 2000 Localization of lung surfactant protein D on mucosal surfaces in human tissues.
10542261 1999 Microfibril-associated protein 4 is present in lung washings and binds to the collagen region of lung surfactant protein D.
10485905 1999 Cloning of gp-340, a putative opsonin receptor for lung surfactant protein D.
10368295 1999 Crystal structure of the trimeric alpha-helical coiled-coil and the three lectin domains of human lung surfactant protein D.
9777404 1998 Structural aspects of collectins and receptors for collectins.
9751757 1998 Altered surfactant homeostasis and alveolar type II cell morphology in mice lacking surfactant protein D.
9153228 1997 Isolation and characterization of a new member of the scavenger receptor superfamily, glycoprotein-340 (gp-340), as a lung surfactant protein-D binding molecule.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8630261 1996 Characterization of the human surfactant protein D promoter: transcriptional regulation of SP-D gene expression by glucocorticoids.
8428971 1993 Genomic organization of human surfactant protein D (SP-D). SP-D is encoded on chromosome 10q22.2-23.1.
8424457 1993 Accumulation of surfactant protein D in human pulmonary alveolar proteinosis.
8406480 1993 Assignment of the human pulmonary surfactant protein D gene (SFTP4) to 10q22-q23 close to the surfactant protein A gene cluster.
8226864 1993 A different combination of transcription factors modulates the expression of the human transferrin promoter in liver and Sertoli cells.
8006040 1994 Molecular structure of pulmonary surfactant protein D (SP-D).
1932100 1991 Characterization of pulmonary surfactant protein D: its copurification with lipids.
1898081 1991 Human surfactant protein D: SP-D contains a C-type lectin carbohydrate recognition domain.
1400434 1992 Pulmonary surfactant protein D specifically binds to phosphatidylinositol.
1339284 1992 Purification, characterization and cDNA cloning of human lung surfactant protein D.