Property Summary

NCBI Gene PubMed Count 41
PubMed Score 207.30
PubTator Score 2174.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
non-small cell lung cancer -3.791 9.9e-10
lung cancer -10.400 1.0e-07
active Crohn's disease 3.156 9.0e-03
active ulcerative colitis 1.058 3.7e-02
lung adenocarcinoma -2.260 3.3e-02

 GO Function (1)

Protein-protein Interaction (1)

Gene RIF (32)

PMID Text
26950992 Significant differences in frequency of occurrence of unfavorable genotypes CC rs1965708, AA rs1059046 of SFTPA2 gene and CC rs1130866 of SFTPB gene in influenza patients in comparison with individuals of the control group were not detected.
26568241 In a Dutch cohort study of unrelated patients with idiopathic or familial interstitial pneumonia genetic analysis of SFTPA2 three new mutations in exon 6 of SFTPA2: N210T, G231R, and N171Y were identified. None were found in the control group.
26061924 Investigated the relationship between SP-A2 and SP-B gene polymorphisms and respiratory distress syndrome in preterm neonates.
25957169 Genetic variation in SP-A2 leads to differential binding to Mycoplasma pneumoniae membranes and regulation of host responses.
25514367 Expression of SFTPA2 mRNA and total SP-A protein was significantly lower in cancer tissue.
24984162 In this study, the loci and haplotypes associated with pulmonary tuberculosis (PTB) were found mostly to be located in the SFTPA2 gene, suggesting that the effects of the SFTPA2 gene on PTB are stronger than those of SFTPA1.
24960334 In this review, we highlight the associations of eosinophilic lung diseases with SP-A and SP-D levels and functions.
24954098 This study shows that changes occur in the alveolar macrophage proteome in response to a single in vivo treatment with exogenous SP-A1 and/or SP-A2.
24950659 data suggest an effect of genetic variants of SFTPA2 on the severity of pandemic H1N1 infection
24793167 sequence variability at the 3'UTR of SFTPA1 and SFTPA2 gene variants differentially affects miRNA regulation of gene expression.
23525782 proteins including the 14-3-3 family bind two cis-elements within exon B of hSP-A2 mRNA in a sequence- and secondary structure-specific manner.
23328842 findings show rs1650232 is in partial linkage disequilibrium with known SP-A2 marker single-nucleotide polymorphisms previously associated with risk for respiratory diseases including tuberculosis
23069847 The aim of this report is to describe the genetic complexity of the SFTPA1 and SFTPA2 genes, as well as to review regulatory mechanisms that control SP-A expression in humans and other animal species.[review]
23056344 SP-A2 G231V and F198S mutants impair the dimmer/trimer assembly, which contributes to the protein sialylation and secretion deficiency. The intracellular protein mutants could be partially degraded through the proteasome pathway and formed aggregates
23038062 Surfactant protein A associated with respiratory distress syndrome in Korean preterm infants: evidence of ethnic difference.
21840962 The untranslated exon B of human surfactant protein A2 mRNAs is an enhancer for transcription and translation.
21601013 there is an association of risk for severe acute respiratory syncytial infection in variant forms of the surfactant protein A2 allele
20963503 These results indicate that the gene polymorphism at the residue 223 in the carbohydrate recognition domain of SFTPA2 may be a genetic marker for the development of allergic rhinitis in the adult Chinese Han population.
20466729 The mechanism of pulmonary fibrosis does not involve an overt lack of secreted SP-A but instead involves an increase in endoplasmic reticulum stress of resident type II alveolar epithelial cells.
20448439 Observational study of gene-disease association. (HuGE Navigator)
20048345 Electron microscopy analysis revealed that hTG mice with a single SP-A1(6A(4)) or SP-A2(1A(3)) gene product lacked tubular myelin (TM), but hTG mice carrying both had TM.
19914637 SP-A2 polymorphisms are associated with the severity of respiratory syncytial virus infection in infants
19543369 Observational study of gene-disease association. (HuGE Navigator)
19392648 SP-A1 and SP-A2, in addition to their roles in surfactant-related functions, play an important role in the modulation of lung host defense.
19100526 These data are consistent with SFTPA2 germline mutations that interfere with protein trafficking and cause familial IPF and lung cancer.
18983439 Observational study of gene-disease association. (HuGE Navigator)
18828058 The amniotic fluid concentration of SP-A decreases in spontaneous human parturition at term.
18487360 TTF-1 response element is critical for temporal and spatial regulation and necessary for hormonal regulation of human surfactant protein-A2 promoter activity
17580966 Residue 85 plays an important role in the structure and function of SP-A and is a major factor for the differences between SP-A1 and SP-A2 variants.
16489761 We conclude that SP-A permeabilizes phospholipid membranes in an LPS-dependent and rough LPS-specific manner, that the effect is neither SP-A- nor species-specific, and that oxidative damage to SP-A abolishes its membrane destabilizing properties
16406431 Decreased levels of SP-A and SP-D have been measured in bronchoalveolar lavage fluid of these patients, as well as patients with acute pneumonia but no chronic lung disease. (review)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MWLCPLALNLILMAASGAACEVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPP      1 - 70
GNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFS     71 - 140
SNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTN    141 - 210
WYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF                                    211 - 248
//

Text Mined References (41)

PMID Year Title
26950992 [ASSOCIATION OF POLYMORPHISM GENES OF SURFACTANT PROTEINS IN PATIENTS WITH INFLUENZA].
26568241 2015 SFTPA2 Mutations in Familial and Sporadic Idiopathic Interstitial Pneumonia.
26061924 2015 Human Surfactant Proteins A2 (SP-A2) and B (SP-B) Genes as Determinants of Respiratory Distress Syndrome.
25957169 2015 Genetic variation in SP-A2 leads to differential binding to Mycoplasma pneumoniae membranes and regulation of host responses.
25514367 2015 DNA methylation profile and expression of surfactant protein A2 gene in lung cancer.
24984162 2014 Correlation analysis between single nucleotide polymorphisms of pulmonary surfactant protein A gene and pulmonary tuberculosis in the Han population in China.
24960334 2014 Eosinophil-associated lung diseases. A cry for surfactant proteins A and D help?
24954098 2014 Sex differences in the acute in vivo effects of different human SP-A variants on the mouse alveolar macrophage proteome.
24950659 2014 Surfactant protein A genetic variants associate with severe respiratory insufficiency in pandemic influenza A virus infection.
24793167 2014 An 11-nt sequence polymorphism at the 3'UTR of human SFTPA1 and SFTPA2 gene variants differentially affect gene expression levels and miRNA regulation in cell culture.
23525782 2013 Exon B of human surfactant protein A2 mRNA, alone or within its surrounding sequences, interacts with 14-3-3; role of cis-elements and secondary structure.
23328842 2013 Allelic mRNA expression imbalance in C-type lectins reveals a frequent regulatory SNP in the human surfactant protein A (SP-A) gene.
23069847 2013 Genetic complexity of the human surfactant-associated proteins SP-A1 and SP-A2.
23056344 2012 Human surfactant protein A2 gene mutations impair dimmer/trimer assembly leading to deficiency in protein sialylation and secretion.
23038062 2013 Surfactant protein A associated with respiratory distress syndrome in Korean preterm infants: evidence of ethnic difference.
21840962 2011 The untranslated exon B of human surfactant protein A2 mRNAs is an enhancer for transcription and translation.
21601013 2011 SP-A1, SP-A2 and SP-D gene polymorphisms in severe acute respiratory syncytial infection in Chilean infants.
20963503 2011 Relationship between surfactant protein A polymorphisms and allergic rhinitis in a Chinese Han population.
20693318 2010 Human SP-A1 (SFTPA1) variant-specific 3' UTRs and poly(A) tail differentially affect the in vitro translation of a reporter gene.
20466729 2010 Surfactant protein A2 mutations associated with pulmonary fibrosis lead to protein instability and endoplasmic reticulum stress.
20448439 2010 Polymorphisms in the surfactant protein a gene are associated with the susceptibility to recurrent urinary tract infection in chinese women.
20048345 2010 Humanized SFTPA1 and SFTPA2 transgenic mice reveal functional divergence of SP-A1 and SP-A2: formation of tubular myelin in vivo requires both gene products.
19914637 2010 Surfactant protein A2 polymorphisms and disease severity in a respiratory syncytial virus-infected population.
19543369 2009 Comprehensive linkage and association analyses identify haplotype, near to the TNFSF15 gene, significantly associated with spondyloarthritis.
19392648 2009 Genetic complexity of the human innate host defense molecules, surfactant protein A1 (SP-A1) and SP-A2--impact on function.
19100526 2009 Genetic defects in surfactant protein A2 are associated with pulmonary fibrosis and lung cancer.
18983439 2009 Surfactant protein A and D gene polymorphisms and protein expression in victims of sudden infant death.
18828058 2008 The concentration of surfactant protein-A in amniotic fluid decreases in spontaneous human parturition at term.
18487360 2008 TTF-1 response element is critical for temporal and spatial regulation and necessary for hormonal regulation of human surfactant protein-A2 promoter activity.
17580966 2007 Effect of cysteine 85 on biochemical properties and biological function of human surfactant protein A variants.
16489761 2006 Pulmonary collectins selectively permeabilize model bacterial membranes containing rough lipopolysaccharide.
16406431 2006 [Pseudomonas aeruginosa and Surfactant-associated Proteins A and D].
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9813381 1998 Genetics of the hydrophilic surfactant proteins A and D.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
3755136 1986 Isolation and characterization of cDNA clones for the 35-kDa pulmonary surfactant-associated protein.
2610270 1989 Studies of the structure of lung surfactant protein SP-A.
1372511 1992 Characterization of a second human pulmonary surfactant-associated protein SP-A gene.