Property Summary

NCBI Gene PubMed Count 34
PubMed Score 25.83
PubTator Score 46.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.300 3.1e-06
psoriasis -1.100 1.1e-03
osteosarcoma 2.019 1.2e-06
group 4 medulloblastoma 1.500 3.8e-06
atypical teratoid / rhabdoid tumor 1.100 5.5e-04
medulloblastoma, large-cell 1.600 6.0e-06
intraductal papillary-mucinous neoplasm ... -1.300 1.8e-03
adult high grade glioma 1.200 2.2e-03
posterior fossa group B ependymoma 1.200 1.5e-05
inflammatory breast cancer -1.100 1.2e-05
ovarian cancer 1.400 1.1e-09

Protein-protein Interaction (4)

Gene RIF (21)

PMID Text
26437079 The SET domain is needed for the 5' end of ss-overhang cleavage with fork and non-fork DNA without affecting the Metnase-DNA interaction. This domain has a positive role in restart of replication fork and the 5' end of ss-overhang cleavage.
25795785 methylation of snRNP70 by SETMAR regulates constitutive and/or alternative splicing
25333365 Metnase may possess an important role in DNA repair, topoisomerase II function, and the maintenance of stemness during colon cancer development.
24655462 293 T transfected with Metnase revealed a large number of rescued plasmids.
24607956 found known and novel SETMAR splice variants to be significantly increased in acute myeloid leukemia
24573677 a single mutation DDN(610) --> DDD(610), which restores the ancestral catalytic site, results in loss of function in Metnase
22231448 phosphorylation of Metnase S495 differentiates between these two functions, enhancing DSB repair and repressing replication fork restart.
21491884 a role for Metnase's endonuclease activity in promoting the joining of noncompatible ends
21187428 DNA repair protein Metnase (also SETMAR), which has a SET histone methylase domain, localized to an induced DSB and directly mediated the formation of H3K36me2 near the induced DSB
21124928 Data show that DBN1, SETMAR and HIG2 are direct transcriptional targets of the SOX11 protein.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20457750 results establish Metnase as a key factor that promotes restart of stalled replication forks, and implicate Metnase in the repair of collapsed forks.
20416268 hPso4, once it forms a complex with Metnase, negatively regulates Metnase's TIR binding activity
19458360 myeloid leukemia cells fail to arrest at the mitotic decatenation checkpoint, and their progression through this checkpoint is regulated by the DNA repair component Metnase (also termed SETMAR)
18790802 Metnase physically interacts and co-localizes with Topoisomerase IIalpha, the key chromosome decatenating enzyme.
18263876 hPso4 is necessary to bring Metnase to the DSB sites for its function(s) in DNA repair
17877369 Results suggest that Metnase's DNA cleavage activity, unlike those of other eukaryotic transposases, is not coupled to its sequence-specific DNA binding.
17403897 The activities of the SETMAR protein on transposon ends are described.
17130240 SETMAR is unlikely to catalyze transposition in the human genome, although the nicking activity may have a role in the DNA repair phenotype.
16989604 These data suggest that vectors based on the Himar1 transposable element, in conjunction with the hyperactive mutant transposase C9, may be suitable vectors for gene therapy applications.
16332963 Metnase is a nonhomologous end-joining repair protein that regulates genomic integration of exogenous DNA and establishes a relationship among histone modification, DNA repair, and integration.

AA Sequence

MFAEAAKTTRPCGMAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQI      1 - 70
TFPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVVQKGLQFH     71 - 140
FQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYIIAIREHVYNGQVMETFV    141 - 210
DPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSEDKERLDH    211 - 280
GKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQ    281 - 350
IRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAI    351 - 420
IEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLD    421 - 490
RIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYA    491 - 560
QEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHL    561 - 630
NNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD                    631 - 684
//

Text Mined References (40)

PMID Year Title
26437079 2015 The SET Domain Is Essential for Metnase Functions in Replication Restart and the 5' End of SS-Overhang Cleavage.
25795785 2015 A Proteomic Strategy Identifies Lysine Methylation of Splicing Factor snRNP70 by the SETMAR Enzyme.
25333365 2014 Potential role for the Metnase transposase fusion gene in colon cancer through the regulation of key genes.
24655462 2014 Fidelity of end joining in mammalian episomes and the impact of Metnase on joint processing.
24607956 2014 Delineation of known and new transcript variants of the SETMAR (Metnase) gene and the expression profile in hematologic neoplasms.
24573677 2014 The DDN catalytic motif is required for Metnase functions in non-homologous end joining (NHEJ) repair and replication restart.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22231448 2012 Chk1 phosphorylation of Metnase enhances DNA repair but inhibits replication fork restart.
21491884 2011 Biochemical characterization of metnase's endonuclease activity and its role in NHEJ repair.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21187428 2011 Methylation of histone H3 lysine 36 enhances DNA repair by nonhomologous end-joining.
21124928 2010 Gene expression profiling and chromatin immunoprecipitation identify DBN1, SETMAR and HIG2 as direct targets of SOX11 in mantle cell lymphoma.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20620605 2010 The transposase domain protein Metnase/SETMAR suppresses chromosomal translocations.
20521842 2010 Crystal structure of the human Hsmar1-derived transposase domain in the DNA repair enzyme Metnase.
20457750 2010 Metnase promotes restart and repair of stalled and collapsed replication forks.
20416268 2010 Regulation of Metnase's TIR binding activity by its binding partner, Pso4.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19458360 2009 Metnase mediates chromosome decatenation in acute leukemia cells.
19390626 2009 Metnase mediates resistance to topoisomerase II inhibitors in breast cancer cells.
18790802 2008 The SET and transposase domain protein Metnase enhances chromosome decatenation: regulation by automethylation.
18263876 2008 Human Pso4 is a metnase (SETMAR)-binding partner that regulates metnase function in DNA repair.
17877369 2007 Biochemical characterization of a SET and transposase fusion protein, Metnase: its DNA binding and DNA cleavage activity.
17403897 2007 The ancient mariner sails again: transposition of the human Hsmar1 element by a reconstructed transposase and activities of the SETMAR protein on transposon ends.
17130240 2007 The human SETMAR protein preserves most of the activities of the ancestral Hsmar1 transposase.
16989604 2006 Hyperactive Himar1 transposase mediates transposition in cell culture and enhances gene expression in vivo.
16672366 2006 Birth of a chimeric primate gene by capture of the transposase gene from a mobile element.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16332963 2005 The SET domain protein Metnase mediates foreign DNA integration and links integration to nonhomologous end-joining repair.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9461395 1997 Molecular evolution of an ancient mariner transposon, Hsmar1, in the human genome.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7670491 1995 Gene-based sequence-tagged-sites (STSs) as the basis for a human gene map.