Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.84
PubTator Score 5.34

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer -1.600 2.1e-03
hepatocellular carcinoma -1.400 1.6e-04
osteosarcoma -3.330 4.8e-09
medulloblastoma, large-cell -1.100 3.6e-04
subependymal giant cell astrocytoma 1.313 3.3e-02
ovarian cancer -1.500 1.6e-09
pituitary cancer 1.300 4.5e-05

Protein-protein Interaction (10)

Gene RIF (5)

PMID Text
26709698 these findings identify Setdb2 as a novel regulator of the immune system in acute respiratory viral infection.
26378653 Results indicate that the IgE-associated AT/G polymorphism (rs386770867) regulates transcription of SETDB2.
20404330 Results provide evidence that CLLD8/KMT1F is recruited to heterochromatin regions and contributes in vivo to the deposition of trimethyl marks in concert with SUV39H1/KMT1A.SUV39H1/KMT1A.
20085599 Observational study of gene-disease association. (HuGE Navigator)
18498648 HIV-1 Tat associates with SETDB2 in vitro

AA Sequence

MGEKNGDAKTFWMELEDDGKVDFIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVNEATIINSSTSIKG      1 - 70
ASQKEVNAQSSDPMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTENKEILSLEDKVVDFREKDSSSNL     71 - 140
SYQSHDCSGACLMKMPLNLKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYKTPCGRSLRNVEEVFRYLL    141 - 210
ETECNFLFTDNFSFNTYVQLARNYPKQKEVVSDVDISNGVESVPISFCNEIDSRKLPQFKYRKTVWPRAY    211 - 280
NLTNFSSMFTDSCDCSEGCIDITKCACLQLTARNAKTSPLSSDKITTGYKYKRLQRQIPTGIYECSLLCK    281 - 350
CNRQLCQNRVVQHGPQVRLQVFKTEQKGWGVRCLDDIDRGTFVCIYSGRLLSRANTEKSYGIDENGRDEN    351 - 420
TMKNIFSKKRKLEVACSDCEVEVLPLGLETHPRTAKTEKCPPKFSNNPKELTVETKYDNISRIQYHSVIR    421 - 490
DPESKTAIFQHNGKKMEFVSSESVTPEDNDGFKPPREHLNSKTKGAQKDSSSNHVDEFEDNLLIESDVID    491 - 560
ITKYREETPPRSRCNQATTLDNQNIKKAIEVQIQKPQEGRSTACQRQQVFCDEELLSETKNTSSDSLTKF    561 - 630
NKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHNRNFPLVAFFTNRYVKARTELTWDYGYEAGTV    631 - 700
PEKEIFCQCGVNKCRKKIL                                                       701 - 719
//

Text Mined References (13)

PMID Year Title
26709698 2015 Type I Interferon Induced Epigenetic Regulation of Macrophages Suppresses Innate and Adaptive Immunity in Acute Respiratory Viral Infection.
26572639 2016 Left-Right Axis Differentiation and Functional Lateralization: a Haplotype in the Methyltransferase Encoding Gene SETDB2 Might Mediate Handedness in Healthy Adults.
26378653 2015 A functional AT/G polymorphism in the 5'-untranslated region of SETDB2 in the IgE locus on human chromosome 13q14.
25416956 2014 A proteome-scale map of the human interactome network.
20404330 2010 CLLD8/KMT1F is a lysine methyltransferase that is important for chromosome segregation.
20085599 2009 A multi-centre study of candidate genes for wheeze and allergy: the International Study of Asthma and Allergies in Childhood Phase 2.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12754510 2003 Positional cloning of a quantitative trait locus on chromosome 13q14 that influences immunoglobulin E levels and asthma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11306461 2001 Cloning and characterization of CLLD6, CLLD7, and CLLD8, novel candidate genes for leukemogenesis at chromosome 13q14, a region commonly deleted in B-cell chronic lymphocytic leukemia.