Property Summary

NCBI Gene PubMed Count 10
PubMed Score 24.65
PubTator Score 4.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.8e-04
posterior fossa group A ependymoma 1.100 9.5e-07

Gene RIF (1)

AA Sequence

MVGGLKRKHSDLEEEEERWEWSPAGLQSYQQALLRISLDKVQRSLGPRAPSLRRHVLIHNTLQQLQAALR      1 - 70
LAPAPALPPEPLFLGEEDFSLSATIGSILRELDTSMDGTEPPQNPVTPLGLQNEVPPQPDPVFLEALSSR     71 - 140
YLGDSGLDDFFLDIDTSAVEKEPARAPPEPPHNLFCAPGSWEWNELDHIMEIILGS                  141 - 196
//

Text Mined References (11)

PMID Year Title