Property Summary

NCBI Gene PubMed Count 189
PubMed Score 1078.80
PubTator Score 448.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
non-small cell lung cancer 4.831 1.7e-16
intraductal papillary-mucinous adenoma (... 3.600 1.1e-03
intraductal papillary-mucinous carcinoma... 4.900 1.0e-04
intraductal papillary-mucinous neoplasm ... 4.700 9.3e-04
colon cancer 5.500 8.2e-05
lung cancer 2.200 1.2e-04
ulcerative colitis 4.200 2.4e-07
pancreatic cancer 3.400 8.9e-08
interstitial cystitis -2.900 2.2e-03
lung adenocarcinoma 1.200 1.0e-02
breast carcinoma -1.800 2.3e-19
spina bifida -2.063 4.4e-02
Breast cancer -3.500 2.7e-09
ovarian cancer 1.300 2.7e-03

Gene RIF (178)

PMID Text
26733306 Study shows that Maspin could enhance cisplatin chemosensitivity induced by cell apoptosis in muscle invasive bladder cancer (MIBC) cell lines. Its expression correlated with prognosis of MIBC patients who received cisplatin-based chemotherapy.
26614844 In this review, we discuss the maspin and maspin/HDAC1 interplay in tumor biology and immunology--{REVIEW}
26497917 Results suggest insight into the dynamics of maspin as a metastasis suppressor gene for further molecular research.
26456962 Suggest maspin as immunohistochemical marker anticipating survival in non-small cell lung carcinomas.
26362203 maspin is a useful addition to the diagnostic immunohistochemical panel (S100P, pVHL, and insulin-like growth factor II mRNA-binding protein 3) to help distinguish malignant from benign epithelia on challenging bile duct biopsies.
26329803 The expression of maspin in the A549 and SPCA1 cells was hardly detected.
26296971 Data suggest that hepatitis B virus X protein (HBx) induces gene expressions of microRNAs microRNA-7, -21, and -107 to target the 3' untranslational region (3' UTR) of maspin mRNA.
26263377 The methylation status of the maspin promoter is an important factor that affects the migration and invasion of EVT cells during early pregnancy.
26208903 Depending on maspin expression, tumor cells in suspension and 3D collagen I show the phenotypes of stem-like and dormant tumor cell populations, respectively. Maspin reduces prostate tumor cell plasticity and enhances tumor sensitivity to salinomycin.
26124368 Maspin was not expressed in the normal mucosa.
26095742 Unmethylated-maspin DNA in maternal blood is associated with severe preeclampsia.
26080829 The expression levels of maspin were lower in the cisplatin-resistant tissue and cells, and was enhanced by IGFBP-2 inhibition.
26051724 Tissue array analysis suggests role for maspin in regulating the occurrence of glioma and disease progression.
25977386 Maspin levels are elevated in colonic polyps.
25973084 Nuclear maspin expression is associated with CPG island methylator phenotype, and clinicopathologically correlates with tumor aggressiveness in colorectal cancer.
25973067 Report endothelial cell pathology and maspin expression in liposarcomas versus non-lipomatous soft tissue tumors.
25936422 VEGF-C inhibition reverses resistance of bladder cancer cells to cisplatin via upregulating maspin.
25775950 a total of 500 ESCC cases and 500 matched controls in a Southwest China population were evaluated for six SNPs in the exons of three Serpin genes (SerpinB5, SerpinB2, and SerpinE1).
25553975 U-SERPINB5 and M-SERPINB5 concentrations in maternal plasma during early pregnancy are not associated with pregnancies who delivered small for gestational age neonates.
25459315 Maspin expression in laryngeal carcinoma is a good indicator for postoperative adjuvant radiotherapy treatment results.
25322663 Cytoplasmic maspin expression could be an independent poor prognostic indicator of patients with lung adenocarcinoma measuring <3 cm.
25151033 Hypomethylation of the maspin promoter results in increased expression of maspin in preeclamptic placentas.
25098993 Intensity of maspin expression is more in benign tumors when compared with malignant tumors. The benign tumors showed both nuclear and cytoplasmic expression. Some malignant tumors did express maspin, but mainly in the cytoplasm
25040445 These data show that changes of expression and subcellular localization of maspin may constitute an important biological end point of tumour progression and aid in the classification of lung adenocarcinoma.
24801268 Maspin protein expression is related to the carcinogenesis of oral cavity squamous cell carcinoma.
24772914 Maspin expression in endometrial carcinoma was correlated with VEGF expression, a marker of angiogenesis.
24607789 Myocardin meditates apoptosis in breast cancer through affecting maspin re-expression and epigenetic modification.
24581141 Nuclear location of tumor suppressor protein maspin inhibits proliferation of breast cancer cells without affecting proliferation of normal epithelial cells.
24346847 Our findings showed that maspin expression, which generally correlates with a less aggressive behavior, is significantly higher in atypical hyperplasia and in endometrial endometrioid adenocarcinoma.
24242003 these results identify maspin-induced accumulation of collagen fibers as a cause of disease progression under doxorubicin chemotherapy for breast cancer.
24228118 Report high frequency of coexpression of maspin and p63, as well as maspin and p53, in squamous cell carcinoma of the lung.
24223769 SERPINB5 protein (in its gene DNA methylated and unmethylated form) is highly overexpressed in first trimester maternal plasma.
24114705 Significant positive correlations between levels of serpin B5 and CEA.
24030740 present study suggests a tumor-suppressive effect of cytoplasmic maspin and a tumor-promoting effect of nuclear maspin in melanoma
24002600 High Maspin expression correlates with poor outcome in colorectal cancer after spread to the local lymph nodes.
23924927 Replacing the reactive center loop of maspin caused transfected breast cancer cells to adhere to fibronectin, reduced their migration & invasion, upregulated tumor suppressive genes,& downregulated pro-metastatic & ubiquitin/proteasome genes.
23923074 Maspin expression was detected in 36.6% of prostatic adenocarcinomas versus 93.3% of benign prostatic hyperplasia cases
23922175 Silencing GRP78 expression may suppress the proliferation, adhesion, and migration of prostate cancer cells via maspin and COX-2 regulation.
23818344 Report nuclear/cytoplasmic maspin expression in invasive ductal breast cancer.
23730906 Cytoplasmic maspin expression was significantly higher in the group of patients whose temporal bone squamous cell carcinoma did not recur than in the group experiencing recurrences.
23717449 Maspin expression significantly inhibited cell proliferation.
23410722 data suggest maspin expression may be influenced by preeclampsia and/or the immunological dynamics of pregnancy
23271290 The maspin mRNA expression level in placentae from preeclamptic women was much higher than that from normotensive women.
23115015 Estrogen and progesterone complement each other in nitricoxide-induced maspin synthesis in neutrophils.
23079206 This study demonstrates that the immunostaining profile of pVHL-/IMP3+/maspin+/S100P+ is useful in the distinction of adenocarcinoma of the gallbladder from normal/reactive conditions.
22963136 Maspin nuclear expression, associated with p53 ones, might be used either to select the high-risk microsatellite stable colorectal carcinomas diagnosed in Stage II or those microsatellite instable cases which can respond to 5-Fluorouracil.
22962304 Maspin genetically and functionally associates with gastric cancer by regulating cell cycle progression.
22857708 This study is the first report showing that Snail can negatively regulate maspin expression by directly repressing maspin promoter activity, leading to increased cell migration and invasion.
22825520 Findings suggested that the evaluation of maspin expression in stage T1 bladder tumors is a useful prognostic marker for predicting the tumor behavior.
22780967 The expression of RelB negatively regulates the endogenous expression of maspin in prostate cancer cells in vitro.
22684556 Combined detection of maspin, VM and MVD may help predict the progression and prognosis of NSCLC.
22292406 The decreased expression of P57(kip2) and Maspin in abnormal scar shows that they are cicatrix-related genes. There is a positive relationship between the two genes.
22076034 maspin as a Ku70-interacting molecule and provide the basis for a new endogenous acetylation-based control mechanism.
22011669 According to our data, SERPINB5 was hypomethylated and up-regulated in squamous cell carcinoma.
21943228 Salivary gland carcinomas express maspin and MCM2 with variable levels and cellular localization
21903246 MASPIN protein was 6 times more likely to be detected in cancer specimens that harbor a p53 mutation relative to cancer specimens with a wt p53 gene
21856005 We propose that RelB is an essential molecule controlling the endogenous and the proteasome inhibitor-induced Maspin expression.
21855619 Wogonin inhibits gallbladder carcinoma cell mobility and invasion by upregulating the metastasis suppressor maspin.
21833477 These results indicate that urokinase plasminogen activator, plasminogen activator urokinase receptor and maspin expression patterns may be useful markers for evaluating the clinical course or prognosis of oral squamous cell carcinoma patients
21732742 The laryngeal carcinoma loco-regional recurrence rate was significantly lower (p = 0.041) and the disease-free survival after treatment was significantly longer (p = 0.045) in cases with a nuclear pattern of MASPIN subcellular expression.
21725612 SerpinB5 interacts with KHDRBS3 and FBXO32, and KHDRBS3 can interact with FBXO32 mRNA.
21622623 endogenous HDAC inhibition by maspin may prevent pathologic gene silencing in prostate tumor progression.
21617230 Low maspin in the cytosol is associated with upper urinary tract urothelial carcinoma.
21606500 maspin, uPAR, and beta1 integrin co-immunoprecipitate, suggesting a novel maspin-uPA-uPAR-beta1 integrin mega-complex that regulates mammary epithelial cell adhesion.
21502940 nuclear localization of maspin required for its tumor and metastasis suppressor functions
21439064 The expression of Ets-1, Ang2 and maspin showed close relationship with angiogenesis in ovarian cancer and expression of maspin appeared to be correlated with high grade and microvessel density.
21330826 Our study identified maspin to be highly increased in endometrial cancer tissues compared with normal endometrium, which confirms previous reports suggesting its involvement in endometrial carcinogenesis.
21187389 PAR-1 negatively regulates the expression of the Maspin tumor-suppressor gene in the acquisition of the metastatic melanoma phenotype
21109985 maspin gene could inhibit invasion of gastric cancinoma SGC7901 cells
21069375 findings suggest that maspin expressed in ameloblasts and odontoblasts plays an important physiological role in tooth development through the regulation of matrix formation in dental tissues.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20939879 SERPINB5 and AKAP12 may have a role in increased metastasis in pancreatic ductal adenocarcinoma
20697987 Promoter hypermethylation of Maspin is associated with invasive ductal breast carcinoma.
20517662 maspin expression may be involved in dysplasia-carcinoma sequence and the early steps of gallbladder carcinogenesis.
20459532 In this large and thoroughly documented series of patients with clinicopathological stage C colonic tumour, maspin expression was correlated with few other conventional histopathology variables and was not a significant prognostic factor.
20363977 Maspin could act as an autoantigen of a streptococcal-induced autoimmune response and represents a target of the exaggerated T cell response in psoriasis.
20349288 Investigated maspin, p53 and VEGF expression in patients with squamous cell carcinoma (SCC), adenocarcinoma (AC) and small cell lung carcinoma (SCLC).
20346150 Maspin overexpression is associated with gastrointestinal stromal tumors.
20337574 discusses the evidence that nuclear maspin may be a tumor marker that stratifies the progression and prognosis of different subtypes of non-small-cell lung cancer [REVIEW]
20336301 Surface-bound maspin directly controls bladder carcinoma cell adhesion to the vascular wall
20334895 Our findings suggest a compartment-dependent function of maspin in colorectal cancer, which can be useful in identifying stage II cases with a higher risk for fatal outcome.
20211623 Testisin may promote carcinogenesis by inhibiting tumor suppressor activity of maspin.
20132554 CASP8 and maspin expression are reduced in breast cancer cells due to promoter methylation
20105109 correlation (p=0.08) with disease-free survival in nasopharyngeal carcinoma
20099971 Cytoplasmic medium/high expression level of maspin is associated with colorectal cancer.
20092039 detection of mammaglobin mRNA is useful to determine the effect of therapy while maspin transcripts may indicate more aggressive disease.
20075396 The SERPINB5 gene was hypomethylated in placenta DNA more than in plasma DNA, it did not demonstrate significant differences between preeclamptic and normal groups.
19966016 An IL-6- and sIL-6R-dependent downregulation of the tumour suppressor maspin.
19909580 This finding adds maspin to the list of metastasis suppressor genes possibly involved in the formation of breast cancer brain metastases.
19906413 BRAt increases maspin expression with preferential nuclear localization of maspin. Further, Brat-mediated maspin expression is transcriptionally regulated through an AP1 site within the (-520) to (-297) region of the promoter.
19728335 IKKalpha, IKKbeta, RANK, Maspin, c-FLIP, Cip2 and cyclinD1 were found to show significant differences between hepatocellular tumor tissue and its corresponding adjacent tissue.
19473451 There was a significant correlation between decreased maspin expression and T-category, lymph metastasis, and mode of invasion. Patients with positive maspin expression had a significantly better prognosis.
19462894 Maspin might have inhibitory effects on invasion and metastasis of epithelian ovarian cancer.
19309490 The subcellular expression of maspin in pulmonary adenocarcinomas and correlated with histological grade, proliferative rate, p53 expression, vascular endothelial growth factor-A levels, and prognosis
19222699 Lip squamous cell carcinoma related to solar radiation show an intense presence of maspin protein in almost all tumor cells as well as the neighboring epithelium.
19221500 The integration of PTEN and p53 into a common pathway for the induction of another tumor suppressor, Maspin, constitutes a tumor suppressor network of PTEN/p53/Mapsin that is operational under limited oxygen conditions.
19148518 maspin suppresses the invasive ability of pancreatic ductal adenocarcinoma cells
19147537 PCR confirms maspin and PAI-1 mRNAs exhibit greatest NO-induced induction, which occurred in a p53-dependent manner in a tumor cell line.
19090015 Maspin exhibited a metastasis-suppressive effect, which may be a consequence of the reversal of the malignant phenotype of EC109 cells.
19073519 High maspin expression is associated with squamous cell carcinoma in non-small-cell lung cancer.
18931702 findings implicate maspin in prostate cancer cell response to hypoxia via recruitment of intracellular signaling partners
18698492 P176S (C526T) substitution of maspin may result in a partial loss of the tumor suppressor function of this protein, contributing to decreased susceptibility to apoptosis and malignant progression
18665036 Cytoplasmic maspin may play an important role in lung carcinomas by regulating apoptosis and thus is a favorable prognostic marker for adenocarcinoma patients, whereas the nuclear location may be linked to promotion of angiogenesis.
18597952 Report maspin, E-selectin, and P-selectin expressions in papillary thyroid carcinomas and their correlation with prognostic parameters.
18367129 maspin expression likely plays a role in reducing the tumor cell's ability to seed to bone or in inhibition of growth in the bone microenvironment.
18343598 Maspin expression is directly associated with the biological aggressiveness of ovarian carcinoma.
18247378 maspin protein and mRNA are upregulated by IFIXalpha in breast cancer cells
18236066 MASPIN nuclear location was not a good prognostic factor in laryngeal squamous cell carcinoma.
18234645 maspin may be involved in the occurrence and progression of intraductal papillary mucinous neoplasms of the pancreas
18091326 maspin expression was identified in the cytoplasm and nucleus of gastric glands and gastric adenocarcinoma; maspin expression is inversely correlated with mutant p53 expression in gastric cancer
18091325 this study failed to demonstrate correlation between maspin loss and p53 expression in malignant melanoma using both individual slides and tissue microarray of carcinomas
18060631 5-Aza-CdR treatment upregulated expression of Maspin in breast cancer cells.
18042077 maspin expression excluduing squamous differentiation may become one of the prognostic indicators of endometrioid endometrial carcinooma.
17490717 In gastric carcinogenesis, maspin expression experiences upregulation in gastric precancerous lesions and then slight downregulation with malignant transformation
17458898 Proteasome inhibitors induce maspin expression by activating p38MAPK pathway, and that maspin thus expressed, in turn, augments proteasome inhibitor-induced apoptosis in prostate cancer cells.
17446556 normal breast epithelial cells can induce apoptosis of breast cancer cells through IGFBP-3 and maspin.
17301947 Maspin controls mammary tumor cell migration through inhibiting Rac1 and Cdc42, but not the RhoA GTPase.
17203770 Results suggest that the expression of maspin may correlate with the aggressiveness of colorectal adenocarcinomas.
17203179 maspin is expressed in endometrial cancer and may play a role in the malignant transformation of human endometrial tissue
17189399 maspin as a multifaceted protein, interacting with diverse group of intercellular and extracellular proteins, regulating cell adhesion, motility, apoptosis, and angiogenesis and critically involved in mammary gland development
16936308 Our data suggest that maspin expression in the human placenta is regulated by changes in histone tail modifications.
16892558 Maspin expression is a special feature of papillary thyroid carcinomas and promotor methylation-caused maspin repression plays a major role in gene balance and in the process of tumor determination.
16720730 Maspin is part of the supramolecular structure of the adhesion plaque and it modulates cell adhesion via a beta1 integrin-dependent mechanism.
16633061 study showed that ovarian cancer cell lines expressiing cytoplasmic maspin are more sensitive to cisplatin and that cytoplasmic and nuclear maspin expressing ovarian carcinoma patients have longer survival rates
16614520 maspin expression in invasive ductal carcinoma of the breast was significantly correlated with a higher histologic grade, a larger tumor size, a positive p53 status and shorter survival
16604823 There is decreased maspin expression in intermediate and thick primary melanoma lesions.
16540429 Maspin has been shown to be involved in processes that are important to both tumor growth and metastasis such as cell invasion, angiogenesis, and more recently apoptosis.
16491398 The impaired maspin production was found to be the consequence of impaired insulin induced NO production in breast cancer due to the decrease of insulin receptor binding.
16329135 The current review is intended to summarize these recent findings and discuss a new perspective of maspin in epithelial homeostasis.
16304843 Androgen receptor can recognize and bind to androgen-responsive element and then inhibit activity of maspin promoter.
16227634 Maspin is significantly overexpressed in both active IBD and colitis-associated dysplasia compared to either inactive IBD or normal colonic mucosa, suggesting a potential role in disease "flare" as well as neoplastic progression
16203989 The maspin gene promoter was found to be hypomethylated in placental tissues and densely methylated in maternal blood cells thus serving as a marker for noninvasive prenatal assessment.
16049007 maspin, through its direct interaction with glutathione S-transferase, may inhibit oxidative stress-induced ROS generation and vascular endothelial growth factor A induction
16049006 findings help to elucidate the molecular mechanisms of maspin and suggest an interactive role between maspin and IRF6 in regulating cellular phenotype, the loss of which can lead to neoplastic transformation
16007219 Maspin sensitizes prostate cancer cells to the apoptotic action of doxazosin by interfering with their attachment to extracellular matrix.
15907209 Maspin overexpression modulates tumor cell apoptosis through the regulation of Bcl2 family proteins
15760906 the human tumor suppressor maspin has a conformational switch in the G-helix
15731774 Findings suggest that maspin likely plays a role in disease progression from in situ to invasive carcinoma.
15713631 maspin inhibits tumor progression through the mitochondrial apoptosis pathway.
15688005 Neovascular endothelial cells are highly sensitive to maspin level inside tumor cells.
15620951 Maspin expression in non-small-cell lung cancer was an independent prognostic factor for overall survival. No correlation between maspin & p53 expression was seen in cancer cells. Increased maspin mRNA expression was seen in cancerous tissues from NSCLC.
15608662 Aberrant maspin expression was frequently observed imunohistochemically in biliary tract carcinomas.
15578720 maspin tumor suppressor expression is induced by p53 or TAp63gamma
15501821 the reactive center loop of maspin is exposed but constrained, as seen by x-ray crystallography
15492782 Loss of maspin expression is associated with development and progression of gastric carcinoma
15353310 analysis of the biological activities of maspin in tumor progression [review]
15309707 there is no significant correlation between the expression of VEGF and Maspin in gastric carcinoma
15256060 Abberant methylation of the maspin promoter is an early event in human breast cancer.
15197584 Our data indicate that maspin has prognostic significance for pulmonary adenocarcinoma.
15145521 tamoxifen induction of maspin involves the recruitment of cofactor(s) by ERalpha to the maspin promoter region
15009909 Maspin expression is directly associated with the biological aggressiveness of thyroid carcinoma.
14991928 Reduced expression of maspin contributes to progression of gastric cancer probably by inhibiting cell adhesion, enhancing cell mobility, decreasing cell apoptosis and facilitating angiogenesis.
14743202 Disruption of cell-type-specific methylation of the maspin gene promoter is frequently involved in undifferentiated thyroid cancers.
14732229 maspin may contribute to bladder cancer development; DNA methylation and histone deacetylation may be important for regulating maspin gene activation in bladder cancer cells
14716296 Maspin is identified as a novel DNA hypomethylation target in pancreatic neoplasms.
14670180 human pancreatic carcinoma cells acquire maspin expression through epigenetic derepression of the maspin locus
14578190 demethylation at the maspin gene promoter disrupts the cell-type-specific gene repression in both gastric normal epithelia and gastric cancer
14534696 maspin protein possibly functions as a clinically relevant inhibitor of tumor progression, preventing local invasiveness and further systemic progression of papillary thyroid carcinomas
14532972 maspin protein expression is a special feature in the cascade of papillary thyroid carcinoma genesis and the way of initiating PTC is different from other thyroid carcinoma types
12969792 Up-regulation of maspin is associated with pancreatic ductal adenocarcinomas
12964023 methylation of the maspin gene promoter is a common, a likely, and an early event during the development of papillary thyroid carcinomas
12799381 findings show that the reactive site loop of maspin is required and sufficient to induce cell-extracellular matrix adhesion in two different cell types and for the inhibition of invasion of carcinoma cells
12789271 Gene-profiling experiments of breast cancer cells infected with wt p53 revealed both MASPIN and desmocollin 3 (DSC3) to be p53-target genes, even though both genes are silenced in association with aberrant cytosine methylation of their promoters
12786889 The expression of maspin in epithelial cells could be up-regulated during the progression of ductal carcinoma, and could be correlated with the acquisition of an aggressive phenotype.
12753703 There were three splicing variants in NASG 3'UTR. Its abnormal expression may be an important molecular event in NPC and lung cancer.
12644823 results point to a major role of the maspin gene in estrogen receptor alpha positive breast cancer; maspin mRNA level can have important prognostic significance in human breast cancer
12629351 Hepsin and maspin are inversely expressed in laser capture microdissectioned prostate cancer
12533266 Maspin, a breast tumor suppressor gene is a valuable marker of the disease progression in breast neoplasms.
12425757 The function of maspin as a tumor suppressor gene involved in tumor invasion, metastasis, and angiogenesis may not be limited to breast cancer.
12384513 maspin is a non-inhibitory serpin and protease inhibition does not account for its activity as a tumor suppressor
12366809 maspin may contribute to gastric carcinogenesis
12231537 Maspin overexpression was significantly associated with a high grade, the presence of ascites, a lower likelihood of optimal surgical cytoreduction, and a shorter overall survival. Cytoplasmic maspin associates with a poorer outcome than nuclear.
12220518 Hypermethylation and histone deacetylation lead to silencing of the maspin gene in human breast cancer.
12127964 maspin may be an important signal transduction molecule in its phosphorylated form.
12037665 role in sensitizing breast carcinoma cells to induced apoptosis
11969337 evidence of the temporal expression of maspin during human gestation and suggests a putative role for maspin in regulating the invasive activity of cytotrophoblasts at term
11788595 interaction with types I and III collagen
11751384 Pleiotrophic inhibition of pericellular urokinase-type plasminogen activator system by endogenous tumor suppressive maspin.

AA Sequence

MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGF      1 - 70
QTVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSIKDLT     71 - 140
DGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNKTDTKPVQMMNMEATFCMGNID    141 - 210
SINCKIIELPFQNKHLSMFILLPKDVEDESTGLEKIEKQLNSESLSQWTNPSTMANAKVKLSIPKFKVEK    211 - 280
MIDPKACLENLGLKHIFSEDTSDFSGMSETKGVALSNVIHKVCLEITEDGGDSIEVPGARILQHKDELNA    281 - 350
DHPFIYIIRHNKTRNIIFFGKFCSP                                                 351 - 375
//

Text Mined References (195)

PMID Year Title
26733306 2016 Maspin enhances cisplatin chemosensitivity in bladder cancer T24 and 5637 cells and correlates with prognosis of muscle-invasive bladder cancer patients receiving cisplatin based neoadjuvant chemotherapy.
26614844 2015 Tumor suppressor maspin as a modulator of host immune response to cancer.
26497917 2016 An in silico model to demonstrate the effects of Maspin on cancer cell dynamics.
26456962 2015 Expression of p63, TTF-1 and Maspin in Non-Small Cell Lung Carcinoma and Their Effect on the Prognosis and Differential Diagnosis.
26362203 2015 Diagnostic value of maspin in distinguishing adenocarcinoma from benign biliary epithelium on endoscopic bile duct biopsy.
26329803 2015 Different maspin functions in the lung adenocarcinoma A549 and SPC-A1 cell lines.
26296971 2015 miRNA-7/21/107 contribute to HBx-induced hepatocellular carcinoma progression through suppression of maspin.
26263377 2015 Promoter Hypomethylation of Maspin Inhibits Migration and Invasion of Extravillous Trophoblast Cells during Placentation.
26208903 2015 Maspin Expression in Prostate Tumor Cells Averts Stemness and Stratifies Drug Sensitivity.
26124368 2015 Maspin, a Marker of Serrated Colorectal Polyps.
26095742 2015 Unmethylated-maspin DNA in maternal plasma is associated with severe preeclampsia.
26080829 2015 Inhibition of IGFBP-2 improves the sensitivity of bladder cancer cells to cisplatin via upregulating the expression of maspin.
26051724 2015 The expression of ATF3, MMP-2 and maspin in tissue chip of glioma.
25977386 Maspin highlights colorectal serrated polyps: preliminary findings.
25973084 2015 Nuclear maspin expression correlates with the CpG island methylator phenotype and tumor aggressiveness in colorectal cancer.
25973067 2015 Relationship of endothelial area with VEGF-A, COX-2, maspin, c-KIT, and DOG-1 immunoreactivity in liposarcomas versus non-lipomatous soft tissue tumors.
25936422 2015 VEGF-C inhibition reverses resistance of bladder cancer cells to cisplatin via upregulating maspin.
25775950 2015 Association between SNPs in Serpin gene family and risk of esophageal squamous cell carcinoma.
25553975 2015 Quantification of the placental epigenetic signature of the SERPINB5 gene in maternal plasma of pregnancies complicated by small for gestational age.
25459315 Postoperative radiotherapy for laryngeal carcinoma: the prognostic role of subcellular Maspin expression.
25322663 2015 Cytoplasmic maspin expression is a predictor of poor prognosis in patients with lung adenocarcinoma measuring <3 cm.
25151033 2014 Promoter hypomethylation and increased maspin expression in preeclamptic placentas in a Chinese population.
25098993 Expression of maspin in benign and malignant salivary gland tumors: an immunohistochemical study.
25040445 2014 Maspin expression patterns differ in the invasive versus lepidic growth pattern of pulmonary adenocarcinoma.
24801268 2015 Loss of heterozygosity in mammary serine protease inhibitor (maspin) and p53 at chromosome 17 and 18 in oral cavity squamous cell carcinoma.
24772914 2014 Maspin expression in endometrial hyperplasia and carcinoma, and its relation with angiogenesis.
24607789 2014 Re-expression and epigenetic modification of maspin induced apoptosis in MCF-7 cells mediated by myocardin.
24581141 2014 Nuclear location of tumor suppressor protein maspin inhibits proliferation of breast cancer cells without affecting proliferation of normal epithelial cells.
24346847 2014 Maspin expression, subcellular localization and clinicopathological correlation in endometrial hyperplasia and endometrial adenocarcinoma.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24242003 2014 Maspin influences response to doxorubicin by changing the tumor microenvironment organization.
24228118 2013 High frequency of coexpression of maspin with p63 and p53 in squamous cell carcinoma but not in adenocarcinoma of the lung.
24223769 2013 Non-invasive prenatal testing of trisomy 18 by an epigenetic marker in first trimester maternal plasma.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
24114705 2014 Serpin B5 is a CEA-interacting biomarker for colorectal cancer.
24030740 2014 Maspin expression and melanoma progression: a matter of sub-cellular localization.
24025145 2013 A genome-wide association study of chemotherapy-induced alopecia in breast cancer patients.
24002600 2013 Maspin is a marker for early recurrence in primary stage III and IV colorectal cancer.
23924927 2013 Reactive center loop moiety is essential for the maspin activity on cellular invasion and ubiquitin-proteasome level.
23923074 2013 Expression of Snail transcription factor in prostatic adenocarcinoma in Egypt: correlation with Maspin protein expression and clinicopathologic variables.
23922175 2014 Glucose-regulated protein 78 mediates hormone-independent prostate cancer progression and metastasis through maspin and COX-2 expression.
23818344 Estimation of maspin's subcellular localization in invasive ductal breast cancer via light microscopy and computerized image analysis: a comparative study.
23730906 2013 Expression of the tumour-suppressor maspin in temporal bone carcinoma.
23717449 2013 Elevated maspin expression is associated with better overall survival in esophageal squamous cell carcinoma (ESCC).
23410722 2013 Chorionic plate expression patterns of the maspin tumor suppressor protein in preeclamptic and egg donor placentas.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23271290 2012 Effect of epigenetic modification of maspin on extravillous trophoblastic function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23115015 2014 Effect of progesterone receptor status on maspin synthesis via nitric oxide production in neutrophils in human breast cancer.
23079206 2013 Diagnostic utility of von Hippel-Lindau gene product, maspin, IMP3, and S100P in adenocarcinoma of the gallbladder.
22963136 2013 Possible predictive value of maspin expression in colorectal cancer.
22962304 2012 Maspin genetically and functionally associates with gastric cancer by regulating cell cycle progression.
22857708 2012 Snail transcription factor negatively regulates maspin tumor suppressor in human prostate cancer cells.
22825520 Predictive value of maspin and Ki-67 expression in transurethral resection specimens in patients with T1 bladder cancer.
22780967 2012 [NF-?B subunits regulate maspin expression in prostate cancer cells in vitro].
22684556 2012 Expression of maspin in non-small cell lung cancer and its relationship to vasculogenic mimicry.
22292406 2011 [Expression and significance of P57(kip2) and Maspin in pathological scar].
22076034 2012 Maspin increases Ku70 acetylation and Bax-mediated cell death in cancer cells.
22011669 2012 Genome-wide analysis of DNA methylation and the gene expression change in lung cancer.
21943228 2011 Maspin and MCM2 immunoprofiling in salivary gland carcinomas.
21903246 2011 The regulation of MASPIN expression in epithelial ovarian cancer: association with p53 status, and MASPIN promoter methylation: a gynecologic oncology group study.
21856005 2011 Maspin expression is regulated by the non-canonical NF-?B subunit in androgen-insensitive prostate cancer cell lines.
21855619 2011 Wogonin, an active ingredient of Chinese herb medicine Scutellaria baicalensis, inhibits the mobility and invasion of human gallbladder carcinoma GBC-SD cells by inducing the expression of maspin.
21833477 2011 Expression of urokinase-type plasminogen activator/urokinase-type plasminogen activator receptor and maspin in oral squamous cell carcinoma: Association with mode of invasion and clinicopathological factors.
21732742 2011 Nuclear MASPIN expression relates to a better prognosis in elderly patients with laryngeal carcinoma.
21725612 2011 SerpinB5 interacts with KHDRBS3 and FBXO32 in gastric cancer cells.
21622623 2011 HDAC1 inhibition by maspin abrogates epigenetic silencing of glutathione S-transferase pi in prostate carcinoma cells.
21617230 2011 Prognostic effects and regulation of activin A, maspin, and the androgen receptor in upper urinary tract urothelial carcinoma.
21606500 2011 Maspin, the molecular bridge between the plasminogen activator system and beta1 integrin that facilitates cell adhesion.
21502940 2011 Nuclear localization of maspin is essential for its inhibition of tumor growth and metastasis.
21439064 2011 Expression of Ets-1, Ang-2 and maspin in ovarian cancer and their role in tumor angiogenesis.
21330826 2011 Highly increased maspin expression corresponds with up-regulation of miR-21 in endometrial cancer: a preliminary report.
21269460 2011 Initial characterization of the human central proteome.
21187389 2011 Protease activated receptor-1 inhibits the Maspin tumor-suppressor gene to determine the melanoma metastatic phenotype.
21109985 2011 Effects of shRNA targeting maspin on invasion of gastric carcinoma SGC7901 cell line.
21069375 2010 Possible involvement of maspin in tooth development.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20939879 2010 SERPINB5 and AKAP12 - expression and promoter methylation of metastasis suppressor genes in pancreatic ductal adenocarcinoma.
20697987 2011 Clinical significance of Maspin promoter methylation and loss of its protein expression in invasive ductal breast carcinoma: correlation with VEGF-A and MTA1 expression.
20517662 2010 Aberrant maspin expression is involved in early carcinogenesis of gallbladder cancer.
20459532 2010 Clinicopathological correlates and prognostic significance of maspin expression in 450 patients after potentially curative resection of node-positive colonic cancer.
20363977 2010 Ezrin, maspin, peroxiredoxin 2, and heat shock protein 27: potential targets of a streptococcal-induced autoimmune response in psoriasis.
20349288 2010 Maspin, VEGF and p53 expression in small biopsies of primary advanced lung cancer and relationship with clinicopathologic parameters.
20346150 2010 Maspin expression in gastrointestinal stromal tumors.
20337574 2010 The natural tumor suppressor protein maspin and potential application in non small cell lung cancer.
20336301 2010 Maspin modulates adhesion of bladder carcinoma cells to vascular endothelium.
20334895 2010 Shift from cytoplasmic to nuclear maspin expression correlates with shorter overall survival in node-negative colorectal cancer.
20211623 2010 Interaction of testisin with maspin and its impact on invasion and cell death resistance of cervical cancer cells.
20132554 2010 Caspase 8 and maspin are downregulated in breast cancer cells due to CpG site promoter methylation.
20105109 2010 Expression of MASPIN and angiogenin in nasopharyngeal carcinoma: novel preliminary clinico-pathological evidence.
20099971 2010 Maspin and Nm23-H1 expression in colorectal cancer.
20092039 2010 Mammaglobin and maspin transcripts in blood may reflect disease progression and the effect of therapy in breast cancer.
20075396 2010 MALDI-TOF mass array analysis of RASSF1A and SERPINB5 methylation patterns in human placenta and plasma.
19966016 2010 Interleukin-6 trans-signalling differentially regulates proliferation, migration, adhesion and maspin expression in human prostate cancer cells.
19909580 2010 Expression of metastasis suppressor gene maspin is reduced in breast cancer brain metastases and correlates with the estrogen receptor status.
19906413 2010 BRCA1 185delAG mutant protein, BRAt, up-regulates maspin in ovarian epithelial cells.
19728335 2010 High expression levels of IKKalpha and IKKbeta are necessary for the malignant properties of liver cancer.
19473451 2009 Loss of maspin is a negative prognostic factor for invasion and metastasis in oral squamous cell carcinoma.
19462894 2009 [Expression of maspin and its relation to tumor vascularization in epithelian ovarian cancer].
19309490 2009 Nuclear, compared with combined nuclear and cytoplasmic expression of maspin, is linked in lung adenocarcinoma to reduced VEGF-A levels and in Stage I, improved survival.
19222699 2009 The severity of epithelial dysplasia is associated with loss of maspin expression in actinic cheilitis.
19221500 2009 PTEN and p53 are required for hypoxia induced expression of maspin in glioblastoma cells.
19148518 2009 The effect of aberrant maspin expression on the invasive ability of pancreatic ductal adenocarcinoma cells.
19147537 2009 Focused PCR screen reveals p53 dependence of nitric oxide-induced apoptosis and up-regulation of maspin and plasminogen activator inhibitor-1 in tumor cells.
19090015 2009 Mammary serine protease inhibitor inhibits epithelial growth factor-induced epithelial-mesenchymal transition of esophageal carcinoma cells.
19073519 2008 Expression of maspin in non-small-cell lung cancer: correlation with clinical features.
18931702 2008 Maspin modulates prostate cancer cell apoptotic and angiogenic response to hypoxia via targeting AKT.
18698492 2008 Maspin polymorphism associated with apoptosis susceptibility and in vivo tumorigenesis.
18665036 2008 Cytoplasmic and nuclear maspin expression in lung carcinomas: an immunohistochemical study using tissue microarrays.
18597952 2008 Maspin, E-selectin, and P-selectin expressions in papillary thyroid carcinomas and their correlation with prognostic parameters.
18367129 Maspin reduces prostate cancer metastasis to bone.
18343598 2008 Maspin overexpression correlates with increased expression of vascular endothelial growth factors A, C, and D in human ovarian carcinoma.
18247378 2008 Interferon-inducible protein IFIXalpha inhibits cell invasion by upregulating the metastasis suppressor maspin.
18236066 2008 MASPIN subcellular localization and expression in oral cavity squamous cell carcinoma.
18234645 2008 Expression of the tumor suppressor gene maspin and its significance in intraductal papillary mucinous neoplasms of the pancreas.
18091326 2008 Maspin and p53 protein expression in gastric adenocarcinoma and its clinical applications.
18091325 2008 Maspin and Mutant p53 expression in malignant melanoma and carcinoma: use of tissue microarray.
18060631 2007 Effects of 5-Aza-CdR on cell proliferation of breast cancer cell line MDA-MB-435S and expression of maspin gene.
18042077 2007 Maspin expression is up-regulated during the progression of endometrioid endometrial carcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17490717 2007 Paradoxical expression of maspin in gastric carcinomas: correlation with carcinogenesis and progression.
17458898 2007 Maspin augments proteasome inhibitor-induced apoptosis in prostate cancer cells.
17446556 2007 Proteomics demonstration that normal breast epithelial cells can induce apoptosis of breast cancer cells through insulin-like growth factor-binding protein-3 and maspin.
17301947 2007 Maspin controls mammary tumor cell migration through inhibiting Rac1 and Cdc42, but not the RhoA GTPase.
17203770 Expression of maspin in colorectal cancer.
17203179 2007 Expression of maspin in endometrioid adenocarcinoma of endometrium.
17189399 2006 Maspin: the new frontier.
16936308 2006 Epigenetic regulation of maspin expression in the human placenta.
16892558 2004 [Role of the class II tumor suppressor gene maspin in thyroid carcinogenesis].
16720730 2006 Maspin is physically associated with [beta]1 integrin regulating cell adhesion in mammary epithelial cells.
16633061 2006 Maspin expression is characteristic for cisplatin-sensitive ovarian cancer cells and for ovarian cancer cases of longer survival rates.
16614520 2006 Clinicopathological significance of maspin expression in breast cancer.
16604823 Decreased immunoreactive maspin expression in intermediate thickness and thick primary melanoma lesions.
16540429 2006 Maspin and tumor metastasis.
16491398 2006 The role of insulin dependent NO synthesis in the impaired production of maspin in human breast cancer.
16329135 2006 Tumor suppressive maspin and epithelial homeostasis.
16304843 2005 Identification of androgen-responsive element ARE and Sp1 element in the maspin promoter.
16227634 2005 Aberrant expression of maspin in idiopathic inflammatory bowel disease is associated with disease activity and neoplastic transformation.
16203989 2005 Detection of the placental epigenetic signature of the maspin gene in maternal plasma.
16177791 2005 DNA sequence and analysis of human chromosome 18.
16049007 2005 Tumor-suppressive maspin regulates cell response to oxidative stress by direct interaction with glutathione S-transferase.
16049006 2005 Mammary serine protease inhibitor (Maspin) binds directly to interferon regulatory factor 6: identification of a novel serpin partnership.
16007219 2005 Maspin sensitizes prostate cancer cells to doxazosin-induced apoptosis.
15907209 2005 Maspin overexpression modulates tumor cell apoptosis through the regulation of Bcl-2 family proteins.
15760906 2005 The high resolution crystal structure of the human tumor suppressor maspin reveals a novel conformational switch in the G-helix.
15731774 2005 Maspin expression in CIN 3, microinvasive squamous cell carcinoma, and invasive squamous cell carcinoma of the uterine cervix.
15713631 2005 Maspin mediates increased tumor cell apoptosis upon induction of the mitochondrial permeability transition.
15688005 2005 Targeted expression of maspin in tumor vasculatures induces endothelial cell apoptosis.
15620951 2005 Prognostic significance of the tumor suppressor gene maspin in non-small cell lung cancer.
15608662 2005 Epigenetic status and aberrant expression of the maspin gene in human hepato-biliary tract carcinomas.
15578720 2005 TAp63gamma can substitute for p53 in inducing expression of the maspin tumor suppressor.
15501821 2004 Crystal structure of human maspin, a serpin with antitumor properties: reactive center loop of maspin is exposed but constrained.
15492782 2004 Loss of maspin expression is associated with development and progression of gastric carcinoma with p53 abnormality.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15353310 2004 The promise and challenge toward the clinical application of maspin in cancer.
15309707 2004 Pathobiological significance of vascular endothelial growth factor and Maspin expressions in human gastric carcinoma.
15256060 Aberrant methylation of the maspin promoter is an early event in human breast cancer.
15197584 2004 Prognostic significance of the maspin tumor suppressor gene in pulmonary adenocarcinoma.
15145521 2004 Tamoxifen induces the expression of maspin through estrogen receptor-alpha.
15009909 2004 Maspin expression is directly associated with biological aggressiveness of thyroid carcinoma.
14991928 2004 Maspin expression and its clinicopathological significance in tumorigenesis and progression of gastric cancer.
14761935 2004 Differential gene expression profile of human tonsil high endothelial cells: implications for lymphocyte trafficking.
14743202 2004 Disruption of cell-type-specific methylation at the Maspin gene promoter is frequently involved in undifferentiated thyroid cancers.
14732229 2004 Expression and regulation of tumor suppressor gene maspin in human bladder cancer.
14716296 2004 Identification of maspin and S100P as novel hypomethylation targets in pancreatic cancer using global gene expression profiling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14670180 Human pancreatic carcinoma cells activate maspin expression through loss of epigenetic control.
14578190 2003 Cell-type-specific repression of the maspin gene is disrupted frequently by demethylation at the promoter region in gastric intestinal metaplasia and cancer cells.
14534696 Maspin in thyroid cancer: its relationship with p53 and clinical outcome.
14532972 2003 Proteome analysis identified maspin as a special feature of papillary thyroid carcinoma.
12969792 2003 Clinicopathological significance and molecular regulation of maspin expression in ductal adenocarcinoma of the pancreas.
12964023 2003 Silencing of the maspin gene by promoter hypermethylation in thyroid cancer.
12799381 2003 Sufficiency of the reactive site loop of maspin for induction of cell-matrix adhesion and inhibition of cell invasion. Conversion of ovalbumin to a maspin-like molecule.
12789271 2003 Mutant p53 and aberrant cytosine methylation cooperate to silence gene expression.
12786889 2003 Expression of maspin is up-regulated during the progression of mammary ductal carcinoma.
12753703 2003 [Proteomics-based identification of Maspin differential expression in bronchial epithelial immortalized cells and malignant transformation cells].
12644823 2003 Prognostic value of maspin mRNA expression in ER alpha-positive postmenopausal breast carcinomas.
12629351 2003 Hepsin and maspin are inversely expressed in laser capture microdissectioned prostate cancer.
12533266 2002 Toward re-expressing tumor suppresor gene maspin in breast cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12425757 2002 Expression and regulation of tumor suppressor gene maspin in breast cancer.
12384513 2002 Maspin inhibits cell migration in the absence of protease inhibitory activity.
12366809 2002 Maspin expression in human gastric adenocarcinoma.
12231537 2002 The paradoxical expression of maspin in ovarian carcinoma.
12220518 2002 Hypermethylation and histone deacetylation lead to silencing of the maspin gene in human breast cancer.
12127964 2002 Tyrosine phosphorylation of maspin in normal mammary epithelia and breast cancer cells.
11969337 2002 The tumour suppressor gene maspin is differentially regulated in cytotrophoblasts during human placental development.
11751384 2001 Pleiotrophic inhibition of pericellular urokinase-type plasminogen activator system by endogenous tumor suppressive maspin.
10828881 2000 High tumoral maspin expression is associated with improved survival of patients with oral squamous cell carcinoma.
9433491 1997 Maspin. A tumor suppressing serpin.
9389773 1997 Maspin is an intracellular serpin that partitions into secretory vesicles and is present at the cell surface.
8290962 1994 Maspin, a serpin with tumor-suppressing activity in human mammary epithelial cells.
7797587 1995 The tumor suppressor maspin does not undergo the stressed to relaxed transition or inhibit trypsin-like serine proteases. Evidence that maspin is not a protease inhibitory serpin.
7724531 1995 A serine proteinase inhibitor locus at 18q21.3 contains a tandem duplication of the human squamous cell carcinoma antigen gene.