Property Summary

NCBI Gene PubMed Count 27
PubMed Score 29.79
PubTator Score 60.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
astrocytic glioma -3.100 1.1e-03
ependymoma -3.600 5.5e-04
oligodendroglioma -2.700 6.6e-03
psoriasis -1.500 4.3e-09
glioblastoma -2.700 3.0e-07
osteosarcoma 5.057 1.7e-07
medulloblastoma -3.000 3.6e-07
cystic fibrosis -1.300 7.7e-04
atypical teratoid / rhabdoid tumor -2.700 1.2e-06
medulloblastoma, large-cell -2.900 1.0e-05
primitive neuroectodermal tumor -2.700 1.8e-06
Duchenne muscular dystrophy 1.282 8.1e-09
autosomal dominant Emery-Dreifuss muscul... 1.216 5.4e-03
juvenile dermatomyositis 1.010 5.1e-10
primary pancreatic ductal adenocarcinoma 1.605 2.3e-03
non-small cell lung cancer -1.158 1.1e-09
intraductal papillary-mucinous carcinoma... -1.300 3.6e-02
lung cancer -1.800 8.7e-05
adult high grade glioma -2.200 3.0e-03
pilocytic astrocytoma -2.600 1.7e-06
Polycystic Ovary Syndrome -1.152 3.0e-02
breast carcinoma -1.100 2.1e-08
Pick disease 2.100 1.3e-05
gastric carcinoma 1.500 4.3e-02
ductal carcinoma in situ -1.200 9.4e-03
invasive ductal carcinoma -1.800 1.5e-03
ovarian cancer 2.900 1.8e-05
Breast cancer 1.200 2.3e-05
pancreatic cancer 1.300 3.2e-02

 GO Function (1)

Gene RIF (10)

PMID Text
25293760 Authors report here that the septins SEPT2, -9, -11, and probably -7 form fibrillar structures around the chlamydial inclusion.
22126117 The proteomic discovery of insoluble SEPT11 accumulation in FTLD-U, along with novel pathological associations, highlights a role for this cytoskeleton-associated protein in the pathogenesis of this complex disorder.
21504731 the role of SEPT2 and SEPT11 in the InlB-Met interactions
20978712 Cloned and characterised novel SEPT11 variants and investigated interaction partners of SEPT11 in platelets and human umbilical vein endothelial cells.
20419844 LOH in genes around D4S2964, including ARD1B and SEPT11 may play an important role in hepatocellular carcinoma development and progression
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19234302 SEPT2 is essential for the InlB-mediated entry of Listeria, but SEPT11 is not, which distinguishes the roles of different mammalian septins
17625225 Our finding suggests a role for members of the septin family in the development of proliferative retinal membranes.
17546647 SEPT9 sequence alternations causing hereditary neuralgic amyotrophy are associated with altered interactions with SEPT4/SEPT11 and resistance to Rho/Rhotekin-signaling
15485874 Sept7/9b/11 form a complex that has effects on filament elongation, bundling, or disruption

AA Sequence

MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDP      1 - 70
ATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLF     71 - 140
NYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQ    141 - 210
IYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGNKMAKARQYPWGVVQVENENHCDFVKLREMLIRV    211 - 280
NMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVK    281 - 350
EKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVNNFQKKKAAAQLLQSQAQQSGAQQTKKD    351 - 420
KDKKNASFT                                                                 421 - 429
//

Text Mined References (34)

PMID Year Title
25293760 2014 Septins arrange F-actin-containing fibers on the Chlamydia trachomatis inclusion and are required for normal release of the inclusion by extrusion.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23192594 2013 Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22126117 2011 Aberrant septin 11 is associated with sporadic frontotemporal lobar degeneration.
21504731 2011 A role for septins in the interaction between the Listeria monocytogenes INVASION PROTEIN InlB and the Met receptor.
21269460 2011 Initial characterization of the human central proteome.
20978712 2010 Human endothelial and platelet septin SEPT11: cloning of novel variants and characterisation of interaction partners.
20736409 2010 Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.
20419844 2010 LOH analysis of genes around D4S2964 identifies ARD1B as a prognostic predictor of hepatocellular carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19234302 2009 Septin 11 restricts InlB-mediated invasion by Listeria.
19145258 2009 Septins regulate bacterial entry into host cells.
18443421 2008 GTP binding is required for SEPT12 to form filaments and to interact with SEPT11.
18047794 2007 SEPT12 interacts with SEPT6 and this interaction alters the filament structure of SEPT6 in Hela cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17625225 2007 Septin expression in proliferative retinal membranes.
17546647 2007 SEPT9 sequence alternations causing hereditary neuralgic amyotrophy are associated with altered interactions with SEPT4/SEPT11 and resistance to Rho/Rhotekin-signaling.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16767699 2006 Human endothelial cell septins: SEPT11 is an interaction partner of SEPT5.
15915442 2005 Expression profiling the human septin gene family.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485874 2004 Biochemical and cell biological analyses of a mammalian septin complex, Sept7/9b/11.
15196925 2004 Biochemical and cell biological characterization of a mammalian septin, Sept11.
15140406 Analysis of mammalian septin expression in human malignant brain tumors.
14999297 2004 FLJ10849, a septin family gene, fuses MLL in a novel leukemia cell line CNLBC1 derived from chronic neutrophilic leukemia in transformation with t(4;11)(q21;q23).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11790298 2002 Directed proteomic analysis of the human nucleolus.