| Tdark | Selenide, water dikinase 2 |
Synthesizes selenophosphate from selenide and ATP.
This gene encodes an enzyme that synthesizes selenophosphate from selenide and ATP. Selenophosphate is the selenium donor used to synthesize selenocysteine, which is co-translationally incorporated into selenoproteins at in-frame UGA codons. Genes encoding selenocysteine contain a stem-loop secondary structure in their 3' UTR called a selenocysteine insertion sequence (SECIS) element. The protein encoded by this gene contains a selenocysteine residue in its predicted active site. There is a pseudogene for this gene on chromosome 5. [provided by RefSeq, Aug 2013]
This gene encodes an enzyme that synthesizes selenophosphate from selenide and ATP. Selenophosphate is the selenium donor used to synthesize selenocysteine, which is co-translationally incorporated into selenoproteins at in-frame UGA codons. Genes encoding selenocysteine contain a stem-loop secondary structure in their 3' UTR called a selenocysteine insertion sequence (SECIS) element. The protein encoded by this gene contains a selenocysteine residue in its predicted active site. There is a pseudogene for this gene on chromosome 5. [provided by RefSeq, Aug 2013]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| ulcerative colitis | 2087 | 7.3e-08 |
| osteosarcoma | 7933 | 7.3e-06 |
| invasive ductal carcinoma | 2950 | 1.0e-03 |
| lung cancer | 4473 | 1.1e-03 |
| intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 2.4e-03 |
| ovarian cancer | 8491 | 2.7e-03 |
| Waldenstrons macroglobulinemia | 764 | 3.4e-03 |
| non-inflammatory breast cancer | 208 | 9.3e-03 |
| esophageal adenocarcinoma | 737 | 1.8e-02 |
| pancreatic ductal adenocarcinoma liver metastasis | 1795 | 2.6e-02 |
| astrocytic glioma | 2241 | 4.2e-02 |
| Disease | log2 FC | p |
|---|---|---|
| Waldenstrons macroglobulinemia | 1.165 | 3.4e-03 |
| astrocytic glioma | -1.200 | 4.2e-02 |
| esophageal adenocarcinoma | 1.400 | 1.8e-02 |
| osteosarcoma | -1.458 | 7.3e-06 |
| pancreatic ductal adenocarcinoma liver m... | -1.168 | 2.6e-02 |
| intraductal papillary-mucinous neoplasm ... | 1.400 | 2.4e-03 |
| lung cancer | 1.100 | 1.1e-03 |
| non-inflammatory breast cancer | 1.200 | 9.3e-03 |
| invasive ductal carcinoma | 1.500 | 1.0e-03 |
| ulcerative colitis | -1.300 | 7.3e-08 |
| ovarian cancer | 1.400 | 2.7e-03 |
| PMID | Text | |
|---|---|---|
| 23934683 | miR-185 plays a role in up-regulation of GPX2 and SEPHS2 expression.In the case of SEPHS2 this may contribute to maintaining selenoprotein synthesis. | |
| 15534230 | the Sps1-encoded enzyme depends on a selenium salvage system that recycles l-selenocysteine, whereas the Sps2 enzyme can function with a selenite assimilation system |
MAEASATGACGEAMAAAEGSSGPAGLTLGRSFSNYRPFEPQALGLSPSWRLTGFSGMKGUGCKVPQEALL 1 - 70 KLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGIGMDSCVIPLRHGGLSLVQTTDFF 71 - 140 YPLVEDPYMMGRIACANVLSDLYAMGITECDNMLMLLSVSQSMSEEEREKVTPLMVKGFRDAAEEGGTAV 141 - 210 TGGQTVVNPWIIIGGVATVVCQPNEFIMPDSAVVGDVLVLTKPLGTQVAVNAHQWLDNPERWNKVKMVVS 211 - 280 REEVELAYQEAMFNMATLNRTAAGLMHTFNAHAATDITGFGILGHSQNLAKQQRNEVSFVIHNLPIIAKM 281 - 350 AAVSKASGRFGLLQGTSAETSGGLLICLPREQAARFCSEIKSSKYGEGHQAWIVGIVEKGNRTARIIDKP 351 - 420 RVIEVLPRGATAAVLAPDSSNASSEPSS 421 - 448 //
| PMID | Year | Title | |
|---|---|---|---|
| 24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. | |
| 23934683 | 2013 | Selenium alters miRNA profile in an intestinal cell line: evidence that miR-185 regulates expression of GPX2 and SEPSH2. | |
| 22814378 | 2012 | N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. | |
| 17916946 | 2007 | New developments in selenium biochemistry: selenocysteine biosynthesis in eukaryotes and archaea. | |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. | |
| 15791204 | 2005 | Recoding elements located adjacent to a subset of eukaryal selenocysteine-specifying UGA codons. | |
| 15616553 | 2004 | The sequence and analysis of duplication-rich human chromosome 16. | |
| 15534230 | 2004 | Selenophosphate synthetase genes from lung adenocarcinoma cells: Sps1 for recycling L-selenocysteine and Sps2 for selenite assimilation. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 10608886 | 1999 | Novel selenoproteins identified in silico and in vivo by using a conserved RNA structural motif. | |
| 8986768 | 1996 | Identification of a novel selD homolog from eukaryotes, bacteria, and archaea: is there an autoregulatory mechanism in selenocysteine metabolism? | |
| 7588067 | 1995 | A new approach to the study of haematopoietic development in the yolk sac and embryoid bodies. |
