Property Summary

NCBI Gene PubMed Count 11
PubMed Score 22.86
PubTator Score 12.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.165 3.4e-03
astrocytic glioma -1.200 4.2e-02
esophageal adenocarcinoma 1.400 1.8e-02
osteosarcoma -1.458 7.3e-06
pancreatic ductal adenocarcinoma liver m... -1.168 2.6e-02
intraductal papillary-mucinous neoplasm ... 1.400 2.4e-03
lung cancer 1.100 1.1e-03
non-inflammatory breast cancer 1.200 9.3e-03
invasive ductal carcinoma 1.500 1.0e-03
ulcerative colitis -1.300 7.3e-08
ovarian cancer 1.400 2.7e-03

Gene RIF (2)

PMID Text
23934683 miR-185 plays a role in up-regulation of GPX2 and SEPHS2 expression.In the case of SEPHS2 this may contribute to maintaining selenoprotein synthesis.
15534230 the Sps1-encoded enzyme depends on a selenium salvage system that recycles l-selenocysteine, whereas the Sps2 enzyme can function with a selenite assimilation system

AA Sequence

MAEASATGACGEAMAAAEGSSGPAGLTLGRSFSNYRPFEPQALGLSPSWRLTGFSGMKGUGCKVPQEALL      1 - 70
KLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGIGMDSCVIPLRHGGLSLVQTTDFF     71 - 140
YPLVEDPYMMGRIACANVLSDLYAMGITECDNMLMLLSVSQSMSEEEREKVTPLMVKGFRDAAEEGGTAV    141 - 210
TGGQTVVNPWIIIGGVATVVCQPNEFIMPDSAVVGDVLVLTKPLGTQVAVNAHQWLDNPERWNKVKMVVS    211 - 280
REEVELAYQEAMFNMATLNRTAAGLMHTFNAHAATDITGFGILGHSQNLAKQQRNEVSFVIHNLPIIAKM    281 - 350
AAVSKASGRFGLLQGTSAETSGGLLICLPREQAARFCSEIKSSKYGEGHQAWIVGIVEKGNRTARIIDKP    351 - 420
RVIEVLPRGATAAVLAPDSSNASSEPSS                                              421 - 448
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23934683 2013 Selenium alters miRNA profile in an intestinal cell line: evidence that miR-185 regulates expression of GPX2 and SEPSH2.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
17916946 2007 New developments in selenium biochemistry: selenocysteine biosynthesis in eukaryotes and archaea.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15791204 2005 Recoding elements located adjacent to a subset of eukaryal selenocysteine-specifying UGA codons.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15534230 2004 Selenophosphate synthetase genes from lung adenocarcinoma cells: Sps1 for recycling L-selenocysteine and Sps2 for selenite assimilation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10608886 1999 Novel selenoproteins identified in silico and in vivo by using a conserved RNA structural motif.
8986768 1996 Identification of a novel selD homolog from eukaryotes, bacteria, and archaea: is there an autoregulatory mechanism in selenocysteine metabolism?
7588067 1995 A new approach to the study of haematopoietic development in the yolk sac and embryoid bodies.